Solanum lycopersicum polypeptide Solyc06g072280.2.1

Polypeptide details  
Name Type Length
89
Organism
Description
polypeptide feature inferred from GFF3 feature
Location(s)
SL2.50ch06:44564151..44566097
GFF source
ITAG_eugene
Polypeptide sequence translated polypeptide sequence 
>Solyc06g072280.2.1 Small nuclear ribonucleoprotein E (AHRD V1 ***- B6SK95_MAIZE); contains Interpro domain(s) IPR006649 Like-Sm ribonucleoprotein, eukaryotic and archaea-type, core

MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDQRIEGRIIGFDEYMNLVLDDAEEVNVKKNSRKQLGRILLKGDNITLMMNTGK*
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNASolyc06g072280.2.1SL2.50ch06:44564152..44566407577+n/a
Add items to a list:

Related viewsNone found
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18032816%2Fdetails feature 18032816
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)