Solanum lycopersicum polypeptide Solyc05g055160.2.1

Polypeptide details  
Name Type Length
420
Organism
Description
polypeptide feature inferred from GFF3 feature
Location(s)
SL2.50ch05:64923130..64926148
GFF source
ITAG_eugene
Polypeptide sequence translated polypeptide sequence 
>Solyc05g055160.2.1 DNAJ chaperone (AHRD V1 ***- B0W7V8_CULQU); contains Interpro domain(s) IPR003095 Heat shock protein DnaJ

MFGRAPKKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKCKGKGSKSGASMKCSGCQGSGMKVTIRQLGPSMIQQMQHPCNECKGTGEMINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDTRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDTLSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRKQQQAQEAYDEDDEDMHGGAQRVQCAQQ*
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNASolyc05g055160.2.1SL2.50ch05:64922771..649271611,597-n/a
Add items to a list:

Related viewsNone found
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18046304%2Fdetails feature 18046304
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)