Arabidopsis thaliana polypeptide AT1G17720.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATB, BETA
Length
501
  
Description
Protein phosphatase 2A, regulatory subunit PR55
Location(s)
TAIR10ch01:6093949..6098065
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT1G17720.1 Protein phosphatase 2A, regulatory subunit PR55

MNGGDDAATSGPPPSLEWRFSQVFGERTAGEEVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTKDHGGSRKDLEQTDYPVRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQPANGALFLLSTNDKTIKYWKVQEKKIKKISEMNIDPSESSNIPPQLVTNGLPADKGHDYLSKDFSFPPGGIPSLRLPVVVTSQETNLVARCRRVYAHAHDYHINSISNSSDGETFISADDLRVNLWNLEISNQSFNIVDVKPTNMEDLTEVITSAEFHPIHCNMLAYSSSKGSIRLIDMRQSALCDSHTKLFEEPEAPGSRSFFTEIIASISDIKFSKDGRYILSRDYMTLKLWDINMDSGPVASYQVHEHLRPRLCDLYENDSIFDKFECCLSGDGLRVATGSYSNLFRVFGASQGSTEAATLEASKNPMRRQIQTPARPSRSIGSMTRVVRRGSESPGTEANGNAYDFTTKLLHMAWHPTENSIACAAANSLYMYYA
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT1G17720.1TAIR10ch01:6093208..60983832,565-n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18073642%2Fdetails feature 18073642
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)