Arabidopsis thaliana polypeptide AT1G20693.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
HMGB2, HMG, BETA, 1, NFD2, NFD02
Length
144
  
Description
high mobility group B2
Location(s)
TAIR10ch01:7177282..7178487
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT1G20693.1 high mobility group B2

MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKLEEGPKEDEESDKSVSEVNDEDDAEDGSEEEEDDD
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT1G20693.1TAIR10ch01:7176775..7178820954+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18077137%2Fdetails feature 18077137
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)