Arabidopsis thaliana polypeptide AT1G65680.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATEXPB2, EXPB2, ATHEXP, BETA, 1.4
Length
273
  
Description
expansin B2
Location(s)
TAIR10ch01:24427266..24428399
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT1G65680.1 expansin B2

MTILVVDRYYMLMNLLFALTCLLLNLTHCFSPKKFNISAATTSDSDWSIAGSTWYGNPTGYGSDGGACGYGNAVAQPPFSKMVSAGGPSLFKSGKGCGACYQVKCTSKSACSKNPVTVVITDECPGCVKESVHFDLSGTAFGAMAISGQDSQLRNVGELQILYKKVECNYIGKTVTFQVDKGSNANSFAVLVAYVNGDGEIGRIELKQALDSDKWLSMSQSWGAVWKLDVSSPLRAPLSLRVTSLESGKTVVASNVIPANWQPGAIYKSNVNF
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT1G65680.1TAIR10ch01:24427266..24428399822+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18119224%2Fdetails feature 18119224
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)