Arabidopsis thaliana polypeptide AT2G45070.3

Polypeptide details  
Name Type Organism
Synonyms / aliases
SEC61, BETA
Length
82
  
Description
Preprotein translocase Sec, Sec61-beta subunit protein
Location(s)
TAIR10ch02:18587208..18587456
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT2G45070.3 Preprotein translocase Sec, Sec61-beta subunit protein

MVGSGAPQRGSAAATASMRRRKPTSGAGGGGASGGAAGSMLQFYTDDAPGLKISPNVVLIMSIGFIAFVAVLHVMGKLYFVK
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT2G45070.3TAIR10ch02:18587017..18588259545-n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18185602%2Fdetails feature 18185602
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)