Arabidopsis thaliana polypeptide AT2G45110.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATEXPB4, EXPB4, ATHEXP, BETA, 1.1
Length
259
  
Description
expansin B4
Location(s)
TAIR10ch02:18599575..18601237
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT2G45110.1 expansin B4

MASSQRYFALLALFAVSLKFCYCQNETIDVAGSGTAGVTWYGEPFGAGSTGGACGYGSAVANPPLYAMVSAGGPSLFNNGKGCGTCYQVVCIGHPACSGSPITVTITDECPGGPCASEPVHIDLSGKAMGALAKPGQADQLRSAGVIRVNYKRAACLYRGTNIVFRMDAGANPYYISFVVEYENGDGDLSNVEIQPAGGSFISMQEMRSAVWKVNSGSALRGPFNIRLTSGESHKVIVAYNVIPANWKPDESYRSIVNF
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT2G45110.1TAIR10ch02:18599501..18601339956+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18185637%2Fdetails feature 18185637
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)