Arabidopsis thaliana polypeptide AT3G45960.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATEXLA3, EXPL3, ATEXPL3, ATHEXP, BETA, 2.3, EXLA3
Length
215
  
Description
expansin-like A3
Location(s)
TAIR10ch03:16893058..16893789
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT3G45960.1 expansin-like A3

MATSFFAGHIAAAIPSIYKDGAGCGACFQVRCKNPKLCNSKGTIVMVTDLNTSNQTDLVLSSRAFRAMAKPVVGVDKYLLKQGIVDVEYQRVPCNYGKRNLNVRVEEASKKPNYLAIKLLYQGGQTEVVGIDIAPVGSSQWSYMSRSHGAVWATDKVPTGALQFKFTVTGGYDGKTVWSKRVLPANWNSGRIYDAGVQITDIAQEGCDTCGHIWN
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT3G45960.1TAIR10ch03:16892756..168939001,061+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18232032%2Fdetails feature 18232032
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)