Notice: The contact form functionality has been restored. Apologies for any inconvenience.

Arabidopsis thaliana polypeptide AT3G45970.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATEXLA1, EXPL1, ATEXPL1, ATHEXP, BETA, 2.1, EXLA1
Length
265
  
Description
expansin-like A1
Location(s)
TAIR10ch03:16896238..16897189
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT3G45970.1 expansin-like A1

MGSFLFLIVVIFLFSSSVNACDRCLHRSKAAYFSSASALSSGACAYGSMATSFFAGHIAAAIPSIYKDGAGCGACFQVRCKNPKLCSTKGTIVMITDLNKSNQTDLVLSSRAFRAMAKPIVGADKDLLKQGIVDIEYQRVPCDYGNKNMNVRVEEASKKPNYLEIKLLYQGGQTEVVSIDIAQVGSSPNWGYMTRSHGAVWVTDKVPTGAIQFRFVVTGGYDGKMIWSQSVLPSNWEAGKIYDAGVQITDIAQEGCDPCDAHIWN
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT3G45970.1TAIR10ch03:16896166..16897308989+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18232045%2Fdetails feature 18232045
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)