Arabidopsis thaliana polypeptide AT3G60570.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATEXPB5, EXPB5, ATHEXP, BETA, 1.3
Length
252
  
Description
expansin B5
Location(s)
TAIR10ch03:22391247..22392463
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT3G60570.1 expansin B5

MASSSLKCFSFIVVLTTFFAISLKPCYCHNKTHWNTAGITWYGDREGPGTTGGACGYGDAVAKHPYRCMVSAGGPSLFKDGKGCGACYRLKCDHPLCTKKPIKVMISDECPGCTKESVHFDLSGKAFGALAKRGKGDQLRNLGELKTMIAIHVDAGANPYYMSFAVKFANGDGNFACIEVQPAGGQYMKMEEMRSAVWRLSPGVPLKGPFNIRLTSAVSGKKIIAKGVIPEKWSPGAIYHSKVNFPVQRKQK
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT3G60570.1TAIR10ch03:22391247..22392463759+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18249458%2Fdetails feature 18249458
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)