Arabidopsis thaliana polypeptide AT4G17030.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATEXLB1, EXPR, AT-EXPR, ATEXPR1, ATHEXP, BETA, 3.1, EXLB1
Length
250
  
Description
expansin-like B1
Location(s)
TAIR10ch04:9581817..9583181
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT4G17030.1 expansin-like B1

MKHSHVLLLLFVQVIVLLPLLCLSDDFVNSRATYYGSPDCKANPRGHCGYGEFGRDINNGEVSGVSWRLWNNGTGCGACYQVRCKIPPHCSEEGVYVVATDSGEGDGTDFILSPKAYGRMARPGTENQLYSFGVVNVEYQRIPCRYAGYNLVYKIHEKSYNPHYLAILVLYVGGVNDILAVEVWQEDCKEWRRMRRVFGAVHDLQNPPRGTLTLRFLVYGSAGINWIQSPNAIPADWTAGATYDSNILLT
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT4G17030.1TAIR10ch04:9581586..95832901,093-n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18273082%2Fdetails feature 18273082
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)