Arabidopsis thaliana polypeptide AT4G28250.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATEXPB3, EXPB3, ATHEXP, BETA, 1.6
Length
264
  
Description
expansin B3
Location(s)
TAIR10ch04:14000446..14001945
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT4G28250.1 expansin B3

MQLFPVMLATLCIVLQLLIGSSALATTNRHVSNSHWLPAVATWYGSPNGDGSDGGACGYGTLVDVKPLHARVGAVNPILFKNGEGCGACYKVRCLDKSICSRRAVTVIITDECPGCSKTSTHFDLSGAVFGRLAIAGESGPLRNRGLIPVIYRRTACKYRGKNIAFHVNEGSTDFWLSLLVEFEDGEGDIGSMHIRQAGAREWLEMKHVWGANWCIIGGPLKGPFSIKLTTLSAGKTLSATDVVPRNWAPKATYSSRLNFSPVL
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT4G28250.1TAIR10ch04:14000038..140020691,327-n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18287763%2Fdetails feature 18287763
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)