Arabidopsis thaliana polypeptide AT4G38400.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATEXLA2, EXPL2, ATEXPL2, ATHEXP, BETA, 2.2, EXLA2
Length
265
  
Description
expansin-like A2
Location(s)
TAIR10ch04:17978675..17979665
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT4G38400.1 expansin-like A2

MLQGFLFLLSVVLLFSSSAAACDRCLHSSKAAYFSSASALSSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLNKTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDYGNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTDKVPNGALQFRFVVTAGYDGKMVWSQRVLPANWEAGKSYDAGVQITDIAQEGCDPCDDHIWN
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT4G38400.1TAIR10ch04:17978443..179797401,105-n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18301223%2Fdetails feature 18301223
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)