Arabidopsis thaliana polypeptide AT5G03160.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATP58IPK, P58IPK
Length
482
  
Description
homolog of mamallian P58IPK
Location(s)
TAIR10ch05:750286..752671
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT5G03160.1 homolog of mamallian P58IPK

MDLFRVWSGMDFLAWRGMAYTLLLLNFVFACQLLLLQPLVSALDGQSVDAAELFERASQSIKVKRYSDALDDLNAAIEADPALSEAYFKRASVLRHFCRYEDSENSYQKYLEFKSGDSNAEKELSQLHQAKSALETASTLYESKDIAKALEFVDKVVLVFSPACSKAKLLKVKLLMVSKDYSGAISETGYILKEDENNLEALLLRGRAYYYLADHDIAQRHYQKGLRLDPEHSELKKAYFGLKKLLKKTKSAEDNANKGKLRVSAEEYKEAIALDPEHTANNVHLYLGLCKVSVRLGRGKDGLNSCNEALNIDAELIEALHQRGEAKLLLEDWEGAVEDLKQAAQNSQDMEIHESLGKAEKALKMSKRKDWYKILGISRTASISEIKKAYKKLALQWHPDKNVGNREEAENKFREIAAAYEILGDDDKRARFDRGEDLEDMGGGGGGGYNPFHGGGGGGQQYTFHFEGGFPGGGGGFGGFGF
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT5G03160.1TAIR10ch05:750109..7528051,760+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18305753%2Fdetails feature 18305753
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)