Notice: The contact form functionality has been restored. Apologies for any inconvenience.

Arabidopsis thaliana polypeptide AT5G06290.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
2-Cys, Prx, B, 2CPB
Length
273
  
Description
2-cysteine peroxiredoxin B
Location(s)
TAIR10ch05:1919380..1921211
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT5G06290.1 2-cysteine peroxiredoxin B

MSMASIASSSSTTLLSSSRVLLPSKSSLLSPTVSFPRIIPSSSASSSSLCSGFSSLGSLTTNRSASRRNFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT5G06290.1TAIR10ch05:1919213..19214251,203+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18309701%2Fdetails feature 18309701
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)