Notice: The contact form functionality has been restored. Apologies for any inconvenience.

Arabidopsis thaliana polypeptide AT5G14740.4

Polypeptide details  
Name Type Organism
Synonyms / aliases
CA2, CA18, BETA
Length
330
  
Description
carbonic anhydrase 2
Location(s)
TAIR10ch05:4758257..4762382
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT5G14740.4 carbonic anhydrase 2

MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRCTCFSHFKLELRRMGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCERAVNVSLANLLTYPFVREGVVKGTLALKGGYYDFVNGSFELWELQFGISPVHSI
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT5G14740.4TAIR10ch05:4757972..47626151,511+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18319950%2Fdetails feature 18319950
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)