Arabidopsis thaliana polypeptide AT5G52210.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
ATARLB1, ATGB1, GB1
Length
205
  
Description
GTP-binding protein 1
Location(s)
TAIR10ch05:21205567..21206840
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT5G52210.1 GTP-binding protein 1

MFSLMSGLWSYMFSKTEFNVLILGIDKAGKTTFLEKLKTIYSISEGLPHDRIVPTVGLNIGRIEVSNAKIVFWDLGGQPGLRSIWEKYYEEAHALIYLIDAACPTRFEDSKSALEKALRHEDLQGAPLLILANKQDLTNAVSAEELDRYLDLKKLDERVYMFEAVSGYDGRGIKESIEWLVGVMEKSKRTESLRARAGYTPVPNS
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT5G52210.1TAIR10ch05:21204991..21207097992+n/a
Add items to a list:

Related views  
http%3A%2F%2Fwww.sgn.cornell.edu%3A8080%2Ffeature%2F18359072%2Fdetails feature 18359072
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)