Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U196020

Score 
360
Direction 
Forward
Predicted Peptide Sequence 
PQRTYFILTPDIPSCRANVFILLGVHIATNGRNVGDYLSKFEFVLNGFFTSSIKTHHQYAHLLVGKKPTEKLAKRQPPSLNLAEKEERNE
ASSNYFTMTRGNQREKDRERAQARSGGKAKKNDDGLTPEQRRERDAKALQEKAAKKAAKDAAGGTNAGRRVPRNRKLGVVTSIAVSNLSF
PFCLNVXPPYLFDVLNPNLMISGWEEGLAMLSVFXESMSVFXAVAIPVSIVLIESCNALRAYNFAMAKAGYM
Predicted Coding Sequence 
CCACAAAGGACGTATTTTATCTTGACCCCCGACATCCCAAGCTGTAGAGCTAATGTTTTTATATTGCTCGGTGTCCACATTGCGACCAAT
GGTAGGAATGTTGGTGACTATCTCTCCAAGTTTGAGTTTGTACTGAATGGTTTTTTTACCAGCAGCATCAAGACCCACCATCAGTATGCG
CATCTCCTTGTTGGCAAAAAGCCGACTGAAAAGCTTGCCAAAAGACAGCCXCCATCTTTGAATCTTGCAGAGAAAGAGGAGAGAAATGAA
GCCTCGTCCAACTACTTTACAATGACTCGTGGAAATCAGAGGGAAAAGGATCGGGAAAGAGCTCAAGCCCGCAGTGGTGGTAAAGCCAAG
AAAAACGATGATGGTTTGACTCCTGAGCAGCGCCGTGAAAGGGATGCGAAAGCTCTGCAAGAGAAGGCTGCAAAGAAAGCAGCAAAAGAC
GCTGCGGGGGGGACCAATGCTGGAAGAAGAGTACCAAGAAATAGAAAGCTAGGTGTTGTTACTTCCATTGCAGTCAGTAATTTGTCATTC
CCCTTCTGTTTAAATGTTGXTCCACCTTATTTATTTGATGTCTTGAACCCCAACCTCATGATTAGTGGTTGGGAAGAGGGTCTTGCTATG
TTGTCTGTTTTTGXTGAAAGCATGTCCGTGTTTGAXGCTGTTGCAATACCTGTGTCAATTGTGCTGATAGAGAGTTGTAATGCACTCCGT
GCGTATAATTTTGCAATGGCAAAGGCAGGATATATGTGA\
Edits in Original Sequence 
(5')CCACAAAGGACGTATTTTATCTTGACCCCCGACATCCCAAGCTGTAGAGCTAATGTTTTTATATTGCTCGGTGTCCACATTGCGAC
CAATGGTAGGAATGTTGGTGACTATCTCTCCAAGTTTGAGTTTGTACTGAATGGTTTTTTTACCAGCAGCATCAAGACCCACCATCAGTA
TGCGCATCTCCTTGTTGGCAAAAAGCCGACTGAAAAGCTTGCCAAAAGACAGCCXCCATCTTTGAATCTTGCAGAGAAAGAGGAGAGAAA
TGAAGCCTCGTCCgAACTACTTTACAATGACTCGTGGAAATCAGAGGGAAAAGGATCGGGAAAGAGCTCAAGCCCGCAGTGGTGGTAAAG
CCAAGAAAAACGATGATGGTTTGACTCCTGAGCAGCGCCGTGAAAGGGATGCGAAAGCTCTGCAAGAGAAGGCTGCAAAGAAAGCAGCAA
AAGACGCTGCGGGGGGGACCAATGCTGGAAGtAAGAGTACCAAGAAATAGAAAGCTAGGTGTTGTTACTTCCATTGCAGTCAGTAATTTG
TCATTCCCCTTCTGTTTAAATGTTGXTCCACCTTATTTATTTGATGTCTTGAACgCCCAACCTCATGATTAGTGGTTGGGAAGAGGGTCT
TGCTATGTTGTCTGTTTTTGXTGAAAGCATGTCCGTGTTTGAXGCTGTTGCAATACCTGTGTCAATTGTGCTGATAGAGAGTTGTAATGC
ACTCCGTGCGTATAATTTaTGCAATGGCAAAGGCAGGATATATGTGA\(3')TATCAATGTTAATTAGTGGAGCATTTTGTGTAATTTGC
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGAAGATGACCTTTGTCGAAGGTGGTCCAATAAAGTACATGAAGCACAAGATT
CATGTGATTGACGAAAAGAATTTAGTAACAAAATATTCACTTATCGAAAGTGATGTTCTTGAAAACAAAGCAGAATCAGTTGATTATGAT
GGCAAATTTGAAGCTTCTGCAGATGGAGGATGTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan