ESTScan Details for Unigene SGN-U196033

Score 
423
Direction 
Forward
Predicted Peptide Sequence 
VSFGYTPDNLIYKNLDFGVDLDSRIALVGPNGAGKSTLLKLMIGDLFPTDGMVKRHNHLKIAQYHQHLAEKLDMDMSALQYMMREYPGNE
EEKMRAAIGRFGLTGKAQVMAMKNLSDGQRSRVIFAWLAYRVPHMLLLDEPTNHLDIETIDSLAEALNAWDGGMVLVSHDFRLINQVAHE
IWVCENQAVTRWEGDIMDFKKHLKKRPDWVNEVKILCVTLECDGIAVCPLVXLVPKAMVKSARPITEGEGEKDQ
Predicted Coding Sequence 
GTTTCTTTTGGCTACACACCTGATAACCTCATCTACAAGAATCTTGATTTTGGTGTAGATCTCGACTCCAGAATAGCACTTGTGGGCCCG
AATGGAGCTGGAAAGAGCACACTGCTTAAGCTGATGATAGGGGATTTGTTTCCCACTGACGGCATGGTTAAGCGTCATAATCACCTAAAA
ATTGCACAGTACCACCAGCACTTGGCCGAGAAGCTAGACATGGACATGTCGGCTCTTCAGTACATGATGAGAGAGTACCCAGGGAATGAG
GAGGAGAAGATGAGGGCAGCAATTGGGAGGTTTGGCCTCACAGGTAAAGCTCAAGTAATGGCTATGAAGAACTTGTCAGATGGTCAACGT
AGTCGGGTGATTTTTGCATGGCTGGCTTATAGGGTACCTCACATGCTGCTGTTGGATGAGCCAACCAATCATCTTGATATTGAAACAATC
GACTCACTTGCTGAGGCGTTGAACGCATGGGATGGTGGGATGGTTCTAGTCAGTCACGACTTTAGGCTCATAAACCAGGTGGCCCATGAG
ATCTGGGTATGTGAAAATCAGGCTGTGACACGGTGGGAGGGCGACATCATGGACTTCAAGAAACACTTGAAGAAAAGGCCGGATTGGGTG
AATGAAGTXAAGATACTATGTGTTACATTAGAATGTGATGGTATCGCTGTTTGCCCTTTGGTTGXTTTAGTGCCTAAGGCAATGGTGAAA
TCAGCACGGCCCATCACTGAAGGTGAAGGGGAGAAAGACCAGTAA\
Edits in Original Sequence 
(5')GTTTCTTTTGGCTACACACCTGATAACCTCATCTACAAGAATCTTGATTTTGGTGTAGATCTCGACTCCAGAATAGCACTTGTGGG
CCCGAATGGAGCTGGAAAGAGCACACTGCTTAAGCTGATGATAGGGGATTTGTTTCCCACTGACGGCATGGTTAAGCGTCATAATCACCT
AAAAATTGCACAGTACCACCAGCACTTGGCCGAGAAGCTAGACATGGACATGTCGGCTCTTCAGTACATGATGAGAGAGTACCCAGGGAA
TGAGGAGGAGAAGATGAGGGCAGCAATTGGGAGGTTTGGCCTCACAGGTAAAGCTCAAGTAATGGCTATGAAGAACTTGTCAGATGGTCA
ACGTAGTCGGGTGATTTTTGCATGGCTGGCTTATAGGGTACCTCACATGCTGCTGTTGGATGAGCCAACCAATCATCTTGATATTGAAAC
AATCGACTCACTTGCTGAGGCGTTGAACGCATGGGATGGTGGGATGGTTCTAGTCAGTCACGACTTTAGGCTCATAAACCAGGTGGCCCA
TGAGATCTGGGTATGTGAAAATCAGGCTGTGACACGGTGGGAGGGCGACATCATGGACTTCAAGAAACACTTGAAGAAAAgGGCCGGATT
GGGTGAATGAAGTXAAGATACTATGTGTTACATTAGAATGTGATGGTATCGCTGTTTGCCCTTTGGTTGXTTTAGTGCCTAAGGCAATGG
TGAAATCAGCACGGCCCATCACTGAAGGTGAAGGGGAGAAAGACCAGTAA\(3')GACCTAAGTAACATTAGCTAAGACCACGCCTAGAG
CCGGGTGCTAGAGAGAGGAAGTGATCAAACCATGGTCACATACCGTTTGAACTCTGGTTGTTGTTCGGGCTTCGTCCACTATTTTTGTTA
TCCTCTTTACATATTCTCTTAGGTTTCGGAGAGCTTACATTACAGCTTATTCCTTATGATCACAAATTCTATATTATATTGCTATGTACT
CCAGATTTTTTCAAAGCTATTATGGATTTTTGAAATTATTTTCTTTCTAAGAAAAAAAAAAAAAAAAAAAAAACTCGAGACTAGTTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan