ESTScan Details for Unigene SGN-U196057

Score 
363
Direction 
Forward
Predicted Peptide Sequence 
GRIVAEYDSMGAYTYVSELWRKKQSDXDEVLAKGEVLGVPPAPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPVSKGIVY
GKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDQAHAAIHNDPRINWICNPVHKHRELRGLTSAGKKY
RGLRGRGHLTTKLAPQEGQPGRGTRLCLSAVTVDLLDLLKDCRLLSFFIIWVXVTFILRQIYILKRLHLYWSIRFLSEIGTDIKSXLSGM
RVSARPV
Predicted Coding Sequence 
GGGAGAATAGTAGCAGAATACGACTCAATGGGTGCCTACACTTATGTGTCGGAGCTATGGAGGAAGAAGCAGTCAGATGXTGATGAGGTT
CTTGCAAAGGGTGAGGTGTTGGGAGTACCGCCAGCTCCATCTATTGTCCGTGTCACTAGGCCTACCCGTCCTGACAAGGCACGCCGCCTG
GGCTACAAGGCCAAACAGGGCTATGTGGTCTACCGTGTTCGTGTGAAACGTGGTGGAAGGAAGAGACCAGTTTCCAAGGGTATTGTGTAT
GGTAAACCAACCAATCAGGGAGTCACCCAATTGAAATTCCAGCGCAGCAAGAGATCTGTCGCCGAGGAGCGTGCTGGTAGGAAATTGGGT
GGTCTTAGAGTCCTCAACTCTTACTGGATTAACGAGGATTCAACCTACAAATACTATGAGGTAATATTGGTTGACCAAGCCCATGCTGCT
ATTCACAACGATCCAAGGATCAACTGGATCTGCAACCCAGTGCATAAGCACAGAGAATTACGTGGTCTCACTTCAGCTGGTAAGAAATAC
AGGGGTCTCCGTGGAAGGGGACATCTCACCACAAAGCTCGCCCCTCAAGAAGGGCAACCTGGAAGAGGAACCAGACTCTGTCTCTCCGCC
GTTACCGTTGATCTGCTTGATCTTCTTAAAGATTGCCGCTTGCTTAGTTTTTTCATTATCTGGGTTTTXGTAACTTTCATCTTGAGGCAA
ATTTACATTTTGAAACGACTACATCTGTATTGGAGTATCCGTTTTCTTTCGGAGATAGGAACGGATATTAAGTCCAAXTTATCTGGTATG
AGAGTCAGTGCAAGACCAGTGTGA\
Edits in Original Sequence 
(5')GGGAGAATAGTAGCAGAATAgCGACTCAATGGGTGCCTACACTTATGTGTCGGAGCTATGGAGGAAGAAGCAGTCAGATGXTGATG
AGGTTCTTGCAAAGGGTGAGGTGTTGGGAGTACCGCCAGCTcCCATCTATTGTCCGTGTCACTAGGCCTACCCGTCCTGACAAGGCACGC
CGCCTGGGCTACAAGGCCAAACAGGGCTATGTGGTCTACCGTGTTCGTGTGAAACGTGGTGGAAGGAAGAGACCAGTTTCCAAGGGTATT
GTGTATGGTAAACCAACCAATCAGGGAGTCACCCAATTGAAATTCCAGCGCAGCAAGAGATCTGTCGCCGAGGAGCGTGCTGGTAGGAAA
TTGGGTGGTCTTAGAGTCCTCAACTCTTACTGGATTAACGAGGATTCAACCTACAAATACTATGAGGTAATATTGGTTGACCAAGCCCAT
GCTGCTATTCACAACGATCCAAGGATCAACTGGATCTGCAACCCAGTGCATAAGCACAGAGAATTACGTGGTCTCACTTCAGCTGGTAAG
AAATACAGGGGTCTCCGTGGAAGGGGACATCTgCACCACAAAGCTCGCCCCTCAAGAAGGGCAACCTGGAAGAGGAACCAGACTCTGTCT
CTCCGCCGTTACCGTTGATCTGCTTGATCTTCTTAAAGATTGCCGCTTGCTTAGTTTTTTCATTATCTGGGTTTTXGTAACTTTCATCTT
GAGGCAAATTTACATTTTGAAACGACTACATCTGTATTGGAGTATCCGTTTTCTTTCGGAGATAGGAACGGATATTAAGTCCAAXTTATC
TGGTATGAGAGTCAGTGCAAGACCAGTGTGA\(3')CTTATAGTTTTAAAGAACCTCTTGATTTGCTTTGTTAGACATTATTTATCAAAA
AAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan