ESTScan Details for Unigene SGN-U196104

Score 
596
Direction 
Forward
Predicted Peptide Sequence 
MASSVISSAAVATRTNVTQASMVAPFTGLKSAASFPVTRKNNLDITSIASNGGRVQCMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYL
LQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNFVKCSASVSSPTSQKAT
EFHPYGQPNIITPPMEMFV
Predicted Coding Sequence 
ATGGCTTCCTCAGTGATCTCTTCGGCAGCCGTTGCTACCCGCACCAATGTCACTCAGGCTAGCATGGTTGCACCCTTCACTGGCCTAAAA
TCTGCTGCATCTTTCCCAGTTACTAGGAAGAACAACCTTGACATTACTTCCATTGCTAGCAACGGTGGACGTGTCCAATGCATGCTGGTG
TGGCCACCAATTAACAAGAAGAAGTACGAGACTCTCTCATACCTTCCTGATTTGTCTGACGAGCAATTGCTCAAGGAAATTGAGTACCTT
TTGCAAAAGGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTCGTGTACCGTGAGCACCACAGGTCACCAGGATACTACGAT
GGAAGGTACTGGACAATGTGGAAGTTGCCCATGTTTGGGTGCACTGACGCTACCCAGGTGTTGAATGAGGTCCAAGAGGCCAAGAAGGCT
TACCCACAGGCCTGGATCCGTATTATCGGATTCGATAACTTCGTCAAGTGCAGTGCATCAGTTTCATCGCCTACAAGCCAGAAGGCTACT
GAATTTCACCCTTATGGCCAGCCAAATATAATTACTCCTCCTATGGAGATGTTTGTTTGA\
Edits in Original Sequence 
GTTTTTTTTTTTTTTTTTTACTTTAAAATAAGAGGAAAATTGAACTTTATAGAAACATTTTTTGTTCAACACAATATCATATGTATTGAG
TATCATACAGAACATTACATGACCATGACCAACCATCCATTGGAACACTATTGAATGGCTTTATTCAGAAAAATAAAACTAAGTAGTAAC
GCA
(5')ATGGCTTCCTCAGTGATCTCTTCGGCAGCCGTTGCTACCCGCACCAATGTCACTCAGGCTAGCATGGTTGCACCCTTCACTGG
CCTAAAATCTGCTGCATCTTTCCCAGTTACTAGGAAGAACAACCTTGACATTACTTCCATTGCTAGCAACGGTGGACGTGTCCAATGCAT
GCTGGTGTGGCCACCAATTAACAAGAAGAAGTACGAGACTCTCTCATACCTTCCTGATTTGTCTGACGAGCAATTGCTCAAGGAAATTGA
GTACCTTTTGCAAAAGGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTCGTGTACCGTGAGCACCACAGGTCACCAGGATA
CTACGATGGAAGGTACTGGACAATGTGGAAGTTGCCCATGTTTGGGTGCACTGACGCTACCCAGGTGTTGAATGAGGTCCAAGAGGCCAA
GAAGGCTTACCCACAGGCCTGGATCCGTATTATCGGATTCGATAACgTTCGTCAAGTGCAGTGCATCAGTTTCATCGCCTACAAGCCAGA
AGGCTACTGAATTTCACCCTTATGGCCAGCCAAcATATAATTACTCCTCCTATGGAGATGTTTGTTTGA\(3')TTTGTACCTAGTCTTT
TTTTACCCCTTTCAGAAACTACTGTTTTTTCCTTTGTTTCTTTTTCCTCTTGTACCTGTGTATTTTCCTCCATTCCAACCAAGTTATGAG
AATTTAATAATGATGAATCGGTGCTTATAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan