ESTScan Details for Unigene SGN-U196118

Score 
798
Direction 
Forward
Predicted Peptide Sequence 
MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVI
DAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKVSFTVSFILVKVDVASWLIXVACLLQ
MDATTPKYSKARYDEIVKEVSSYLKKVGYNPX
Predicted Coding Sequence 
ATGGGTAAAGAGAAAATTCACATTAGCATTGTTGTCATTGGTCATGTCGACTCTGGAAAGTCGACCACTACTGGTCATTTGATCTACAAG
CTTGGTGGTATTGACAAGCGTGTCATCGAAAGATTCGAGAAAGAAGCAGCTGAGATGAACAAGAGGTCCTTCAAGTATGCTTGGGTGCTT
GACAAGCTGAAGGCAGAGCGTGAACGTGGTATTACCATTGATATTGCCTTGTGGAAGTTCGAGACCACAAAGTACTACTGCACTGTCATT
GATGCCCCTGGACACAGGGATTTTATCAAGAACATGATTACTGGTACCTCCCAGGCTGACTGTGCTGTCCTCATTATTGACTCCACCACT
GGTGGTTTTGAAGCTGGTATCTCCAAGGATGGACAGACCCGTGAGCACGCATTGCTTGCTTTCACCCTCGGTGTCAAGCAAATGATTTGC
TGCTGTAACAAGGTCTCTTTTACTGTTTCTTTTATTCTTGTGAAAGTTGATGTTGCAAGTTGGCTAATTXCTGTTGCTTGCCTTCTGCAG
ATGGATGCTACCACCCCCAAATACTCCAAGGCCAGGTATGATGAAATTGTGAAGGAAGTTTCTTCCTACCTCAAGAAGGTTGGGTACAAC
CCTGXX\
Edits in Original Sequence 
GTTTTAGCTAAAGTTTCTCTCTCACTTTTCGTACTCTAAAAGTTTCTCAGGCATC(5')ATGGGTAAAGAGAAAATTCACATTAGCATTG
TTGTCATTGGTCATGTCGACTCTGGAAAGTCGACCACTACTGGTCATTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTCATCGAAA
GATTCGAGAAAGAAGCAGCTGAGATGAACAAGAGGTCCTTCAAGTATGCTTGGGTGCTTGACAAGCTGAAGGCAGAGCGTGAACGTGGTA
TTACCATTGATATTGCCTTGTGGAAGTTCGAGACCACAAAGTACTACTGCACTGTCATTGATGCCCCTGGACACAGGGATTTTATCAAGA
ACATGATTACTGGTACCTCCCAGGCTGACTGTGCTGTCCTCATTATTGACTCCACCACTGGTGGTTTTGAAGCTGGTATCTCCAAGGATG
GACAGACCCGTGAGCACGCATTGCTTGCTTTCACCCTCGGTGTCAAGCAAATGATTTGCTGCTGTAACAAGGTCTCTTTTACTGTTaTCT
TTTATTCTTGTGAAAGTTGATGTTGCAAGTTGGCTAATTXCTGTTGCTTGCCTTCTGCAGATGGATGCTACCACCCCCAAATACTCCAAG
GCCAGGTATGATGAAATTGTGAAGGAAGTTTCTTCCTACCTCAAGAAGGTTGGGTACAACCCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan