ESTScan Details for Unigene SGN-U196163

Score 
415
Direction 
Forward
Predicted Peptide Sequence 
MVEKTKGRKEEVVSREYTINLHKRLHGCTFKKKAPTAIKEIRKFAQKAMGTKDVRVDVKLNNKSGAGASEVFQGVSEFXIARKRNDDEDA
KEELYSLVTVAEIPPEGLKGLGTKVIEDDE
Predicted Coding Sequence 
ATGGTGGAGAAAACTAAAGGAAGAAAAGAGGAAGTTGTTTCCAGGGAGTACACCATTAATCTCCACAAGCGTTTACATGGATGCACATTC
AAGAAGAAGGCCCCTACGGCCATCAAGGAGATTAGGAAGTTTGCACAGAAGGCTATGGGCACAAAGGATGTCAGGGTTGATGTGAAGCTC
AACAACAAATCTGGAGCAGGGGCATCCGAAGTGTTCCAAGGCGTGTCAGAGTTCGXTATTGCTCGCAAGAGAAACGACGACGAGGACGCA
AAGGAGGAGCTCTACTCTCTCGTCACAGTTGCAGAGATCCCACCCGAGGGATTAAAGGGTCTCGGTACCAAGGTCATCGAGGATGATGAG
TAA\
Edits in Original Sequence 
CTCCTTCGTCCAAACCCTAGTAAAGTGTTAGTGAGAAAAAAAGGTGAACGAAA(5')ATGGTGGAGAAAACTAAAGGAAGAAAAGAGGAA
GTTGTTTCCAGGGAGTACACCATTAATCTCCACAAGCGTTTACATGGATGCACATTCAAGAAGAAGGCCCCTACGGCCATCAAGGAGATT
AGGAAGTTTGCACAGAAGGCTATGGGCACAAAGGATGTCAGGGTTGATGTGAAGCTCAACAAgCAAATCTGGAGCAGGGGCATCCGAAGT
GTTCCAAGGCGTGTCAGAGTTCGXTATTGCTCGCAAGAGAAACGACGACGAGGACGCAAAGGAGGAGCTCTACTCTCTCGTCACAGTTGC
AGAGATCCCACCCGAGGGATTAAAGGGTCTCGGTACCAAGGTCATCGAGGATGATGAGTAA\(3')ACTCTCATTTTTAGCTAAGAATGA
TACTTCTAGTGCTTTTTGTGATCCAATTTAGTGCTGTGAGACTGCTCAGTTTTGTTTATGATACTAAACCATTTTCGTATTTCAGAGTTC
TCTTTAAGATTTTATGCTATTCATGTTCTAAGTTTCGCCGAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan