ESTScan Details for Unigene SGN-U196311

Score 
390
Direction 
Forward
Predicted Peptide Sequence 
MDMVGKIACFVLLCMVVVAPSAEALSCSQVTSGLAPCLPYLQGRGPLGGCCSGVKDLLAAAKTPADRKTACTCMKSTANSIKGIDAGKAA
SIPATCGVNIPYKISPSTAAPGPVGLIPIIIWYHDEEKNKDGLIQFDHAYGSITIYXRLFPFLSVSAAVLIYX
Predicted Coding Sequence 
ATGGACATGGTTGGCAAAATTGCATGCTTTGTGCTTTTGTGCATGGTGGTGGTTGCACCTTCTGCAGAGGCACTTAGCTGCAGCCAGGTT
ACATCTGGCTTGGCTCCTTGCCTCCCTTATCTGCAGGGTCGTGGCCCTCTCGGAGGCTGTTGTAGTGGAGTTAAGGATCTGCTTGCTGCA
GCCAAGACCCCAGCGGACCGAAAGACAGCATGTACTTGCATGAAATCAACAGCTAATTCGATTAAGGGCATTGATGCAGGCAAAGCAGCC
AGTATCCCTGCTACTTGTGGTGTTAACATTCCATACAAGATTAGTCCTTCCACTGCTGCTCCAGGTCCAGTAGGGCTGATCCCAATCATA
ATTTGGTATCATGATGAGGAGAAGAATAAAGATGGATTAATCCAGTTTGATCATGCTTATGGATCCATCACTATATATGXTCGTCTCTTT
CCTTTTCTATCTGTGTCTGCTGCAGTACTCATATATAXX\
Edits in Original Sequence 
GTCGAGCAACAAATACATTTCATTTGTACTAACCTCCGATCCACTACTCTCCTCATACTACTCTTTGTTATTTCATCGTGTGTCTAATTT
TCTTTATTATATTAAGA
(5')ATGGACATGGTTGGCAAAATTGCATGCTTTGTGCTTTTGTGCATGGTGGTGGTTGCACCTTCTGCAGAG
GCACTTAGCTGCAGCCAGGTTACATCTGGCTTGGCTCCTTGCCTCCCTTATCTGCAGGGTCGTGGCCCTCTCGGAGGCTGTTGTAGTGGA
GTTAAGGATCTGCTTGCTGCAGCCAAGACCCCAGCGGACCGAAAGACAGCATGTACTTGCATGAAATCAACAGCTAATTCGATTAAGGGC
ATTGATGCAGGCAAAGCAGCCAGTATCCCTGCTACTTGTGGTGTTAACATTCCATACAAGATTAGTCCTTCCACTGaCTGCTCCAcGGTC
CAGTAGGGCTGATCCCAATCATAATTTGGTATCATGATGAGGAGAAGAATAAAGATGGATTAATCCAGTTTGATCATGCTTATGGATCCA
TCACTATATATGXTCGTCTCTTTCCTTTTCTATCTGTGTCTGCTGCAGTACTCATATATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan