ESTScan Details for Unigene SGN-U196386

Score 
1107
Direction 
Forward
Predicted Peptide Sequence 
MASLVSSWSSEVNSIPNKYVIPLEKRVNADVPIGKHIPVIDLSQPSNHSIQQIIKASAEFGLFQVINHGVSESLMADALAVCKEFFYLPI
EEKAKFVENKDDESLSDFEPSIDQRPKLYIEKEYTPKKNGSKTNEKETVFWKDTFGHGCHPLTQDVINSWPEKPQKYREVIGEYALELRK
LSLRILDLMCEGLGLEVGYLGKEHSQTQLMVTHHYPQCPDPNSTIGIAEHCDGALINLVQQELSGLHVRSKDGKWFGVEPIPGALVVING
LILKVVSNGKLSAGVHRVVTNSHSDRTSVGTLISPIEXRNEPAKILVNENNPPLFNPFPYTEYLGYYSSDTTEIEPPLKPYKPLLAALKX
Predicted Coding Sequence 
ATGGCATCACTAGTTTCAAGTTGGTCATCAGAAGTGAATTCAATTCCAAATAAATATGTAATTCCATTAGAGAAAAGGGTAAATGCAGAT
GTACCAATAGGTAAACATATTCCAGTTATTGATTTATCACAACCTTCAAATCATTCTATTCAGCAAATCATCAAAGCTTCTGCTGAGTTT
GGTCTCTTTCAGGTGATCAACCATGGAGTTTCAGAAAGCCTAATGGCTGATGCATTAGCAGTTTGCAAAGAGTTTTTCTATCTTCCAATT
GAGGAGAAAGCAAAGTTTGTTGAGAATAAAGATGATGAGAGCTTAAGTGACTTTGAACCATCAATTGACCAAAGGCCAAAACTTTACATT
GAAAAAGAATACACACCAAAGAAAAATGGTTCAAAAACTAATGAGAAAGAAACTGTTTTTTGGAAAGATACTTTTGGACATGGTTGTCAT
CCTCTCACTCAAGATGTCATCAATTCTTGGCCTGAAAAACCACAAAAATATAGAGAAGTGATAGGTGAATATGCATTGGAGTTAAGGAAA
CTGAGCTTGAGGATTTTGGACCTAATGTGTGAAGGACTTGGACTTGAAGTAGGGTATTTGGGGAAAGAACATAGCCAGACTCAACTAATG
GTGACCCACCATTATCCACAATGTCCAGACCCAAATTCAACAATAGGTATAGCTGAACATTGTGATGGTGCACTTATCAATTTGGTCCAG
CAAGAACTAAGTGGATTGCATGTGAGATCAAAGGATGGCAAATGGTTTGGTGTTGAACCAATTCCTGGTGCACTTGTTGTCATCAATGGT
CTGATCTTAAAGGTTGTGAGCAATGGAAAGCTATCAGCAGGAGTACATAGAGTTGTGACAAACTCACATTCTGATAGGACATCAGTTGGC
ACCTTAATAAGTCCAATTGAGXTGCGTAATGAACCTGCAAAAATACTTGTAAATGAGAACAATCCACCATTATTCAACCCATTCCCATAC
ACAGAATATCTGGGATATTATTCCAGTGACACCACTGAAATTGAACCACCATTGAAACCATACAAGCCCCTACTAGCXGCCTTGAAACAX
\
Edits in Original Sequence 
CCAATATCTAAGATATAGTATTATTACTCTCTAAGAGGTAGAAAATTTTCATTAAATTAAGT(5')ATGGCATCACTAGTTTCAAGTTGG
TCATCAGAAGTGAATTCAATTCCAAATAAATATGTAATTCCATTAGAGAAAAGGGTAAATGCAGATGTACCAATAGGTAAACATATTCCA
GTTATTGATTTATCACAACCTTCAAATCATTCTATTCAGCAAATCATCAAAGCTTCTGCTGAGTTTGGTCTCTTTCAGGTGATCAACCAT
GGAGTTTCAGAAAGCCTAATGGCTGATGCATTAGCAGTTTGCAAAGAGTTTTTCTATCTTCCAATTGAGGAGAAAGCAAAGTTTGTTGAG
AATAAAGATGATGAGAGCTTAAGTGACTTTGAACCATCAATTGACCAAAGGCCAAAACTTTACATTGAAAAAGAATACACACCAAAGAAA
AATGGTTCAAAAACTAATGAGAAAGAAACTGTTTTTTGGAAAGATACTTTTGGACATGGTTGTCATCCTCTCACTCAAGATGTCATCAAT
TCTTGGCCTGAAAAACCACAAAAATATAGAGAAGTGATAGGTGAATATGCATTGGAGTTAAGGAAACTGAGCTTGAGGATTTTGGACCTA
ATGTGTGAAGGACTTGGACTTGAAGTAGGGTATTTGGGGAAAGAACATAGCCAGACTCAACTAATGGTGACCCACCATTATCCACAATGT
CCAGACCCAAATTCAACAATAGGTATAGCTGAACATTGTGATGGTGCACTTATCAATTTGGTCCAGCAAGAACTAAGTGGATTGCATGTG
AGATCAAAGGATGGCAAATGGTTTGGTGTTGAACCAATTCCTGGTGCACTTGTTGTCATCAATGGTCTGATCTTAAAGGTTGTGAGCAAT
GGAAAGCTATCAGCAGGAGTACATAGAGTTGTGACAAACTCACATTCTGATAGGACATCAGTTGGCACCTTAATAAGTCCAATTGAGXTG
CGTAATaGAACCTGCAAAAATACTTGTAAATGAGAACAATCCACCATTATTCAACCCATTCCCATACACAGAATATCTGGGATATTATTC
CAGTGACACCACTGAAATTGAACCACCATTGAAACCATACAAGCCCCTACTAGCXGCCTTGAAACAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan