ESTScan Details for Unigene SGN-U196409

Score 
509
Direction 
Forward
Predicted Peptide Sequence 
MALAKAKEIVSANPVVVFSKTTVRSAVSVKDLLAKLGASFKAVELDSEKDGSEIQAALAEWTGQRTVPNVFIVGKHIGGCDATTALHRDG
KLVPLLTEAGAIAKSSTA
Predicted Coding Sequence 
ATGGCACTTGCAAAGGCTAAGGAAATTGTTTCTGCTAATCCAGTTGTGGTCTTCAGCAAGACTACTGTCCGTTCTGCXGTTAGCGTCAAG
GATTTGTTGGCAAAGCTTGGGGCTTCTTTCAAGGCTGTTGAGTTGGATTCTGAAAAGGATGGAAGTGAGATCCAGGCTGCACTGGCTGAG
TGGACTGGTCAGCGAACTGTGCCAAACGTCTTCATTGTGGGGAAGCACATTGGTGGCTGTGACGCCACAACTGCCTTGCACAGGGATGGG
AAGCTTGTTCCTCTGCTAACTGAGGCTGGGGCAATTGCTAAATCTTCTACAGCTTAG\
Edits in Original Sequence 
AATCTGTCTGATCTAGGGTTTTTTGAAAAGCAAATCGATTGAAA(5')ATGGCACTTGCAAAGGCTAAGGAAATTGTTTCTGCTAATCCA
GTTGTGGTCTTCAGCAAGACgTACTGTCCGTTCTGCXGTTAGCGTCAAGGATTTGTTGGCAAAGCTTGGGGCTTCTTTCAAGGCTGTTGA
GTTGGATTCTGAAAAGGATGGAAGTGAGATCCAGGCTGCACTGGCTGAGTGGACTGGTCAGCGAACTGTGCCAAACGTCTTCATTGTGGG
GAAGCACATTGGTGGCTGTGACGCCACAACTGCCTTGCACAGGGATGGGAAGCTTGTTCCTCTGCTAACTGAGGCTGGGGCAATTGCTAA
ATCTTCTACAGCTTAG\(3')AGGATCAGATAGTCGGGTTGTTTAAAGAATCAAATCTCGTGAACTTATCCCATAAGATAAAGTGAATTA
TGTTTCTGTAGCTATGTTGTTAAGTTGACTGTTAGTTGATGCTTCAAAGATGTTGAACGAAATAGTTCATATGAAAATTTTGCTTGAAGC
CTGAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan