ESTScan Details for Unigene SGN-U196410

Score 
881
Direction 
Forward
Predicted Peptide Sequence 
GYDNVEILKFLLSWPGTEQVELEAKNMYGETPLHMAAKNGCNEAAKMLLAHGALVEARANNGMTPLHLAVWHSLRAEDYSAVKTLLEYNA
DCSAEDNEGMTPINHLSQGPGNEKLRELLHGYLEEQRKRKAIEACSQTKAKMDELENELSKIVGLDELKLQLRKWAKGMLLDERRRALGL
KVGARRPPHMAFLGNPGTGKTMVARILGKLLHMVGILPTDKVTEVQRTDLVGEFVGHTGPKTRRKIQEAEGGILFVDEAYRLIPMQKSDD
KDYGLEALEEIMSVMDSGKIVVIFAGYSEPMKRVITSNEGFCRRVTKFFHFDNFSSEDLAKILHLTMTSQADRSLLYGFKLHPSCTADAV
A
Predicted Coding Sequence 
XCTGGTTATGACAATGTCGAAATACTCAAGTTTTTGCTCAGTTGGCCGGGCACAGAGCAGGTGGAGCTTGAAGCCAAGAACATGTATGGG
GAGACACCATTGCACATGGCAGCCAAGAACGGTTGTAATGAAGCAGCAAAGATGCTTCTTGCTCATGGTGCTCTTGTTGAAGCCAGAGCC
AATAATGGGATGACTCCGCTGCACCTTGCTGTTTGGCACTCACTACGAGCCGAAGACTATTCAGCAGTAAAGACATTGTTGGAGTATAAC
GCGGATTGTAGTGCTGAAGACAATGAGGGCATGACTCCTATAAATCATCTCTCTCAAGGCCCCGGAAATGAAAAATTGCGCGAACTGCTC
CATGGGTATCTTGAAGAACAAAGAAAACGTAAAGCCATTGAAGCATGCAGCCAAACTAAAGCTAAAATGGATGAACTTGAAAACGAATTA
TCTAAAATAGTGGGGTTAGACGAACTTAAACTGCAACTCCGCAAATGGGCAAAGGGGATGCTCTTGGATGAGAGGCGTAGGGCCCTAGGG
CTTAAAGTCGGTGCAAGAAGACCACCCCATATGGCTTTCCTTGGAAACCCCGGAACAGGAAAAACTATGGTTGCTCGAATTCTTGGAAAA
TTACTTCATATGGTTGGGATTCTTCCTACTGACAAGGTGACAGAGGTGCAGAGAACAGATCTGGTTGGTGAATTTGTTGGTCATACAGGG
CCAAAGACGAGGAGAAAGATCCAAGAAGCTGAAGGGGGGATTCTTTTTGTTGATGAAGCCTATCGATTAATACCTATGCAGAAGTCGGAT
GACAAGGACTATGGTTTGGAAGCGCTAGAGGAGATAATGTCTGTTATGGACAGCGGGAAAATTGTAGTAATTTTTGCAGGTTACAGTGAA
CCAATGAAGCGCGTGATCACTTCTAATGAAGGTTTCTGTAGAAGAGTAACAAAGTTTTTCCATTTCGACAACTTTAGCTCTGAAGACCTT
GCGAAGATTCTTCATCTTACAATGACCAGTCAAGCTGATCGTAGCTTGCTATATGGATTTAAGCTGCATCCTTCATGTACCGCTGATGCA
GTTGCX\
Edits in Original Sequence 
(5')XCTGGTTATGACAATGTCGAAATACTCAAGTTTTTGCTCAGTTGGCCGGGCACAGAGCAGGTGGAGCTTGAAGCCAAGAACATGTA
TGGGGAGACACCATTGCACATGGCAGCCAAGAACGGTTGTAATGAAGCAGCAAAGATGCTTCTTGCTCATGGTGCTCTTGTTGAAGCCAG
AGCCAATAATGGGATGACTCCGCTGCACCTTGCTGTTTGGCACTCACTACGAGCCGAAGACTATTCAGCAGTAAAGACATTGTTGGAGTA
TAACGCGGATTGTAGTGCTGAAGACAATGAGGGCATGACTCCTATAAATCATCTCTCTCAAGGCCCCGGAAATGAAAAATTGCGCGAACT
GCTCCATGGGTATCTTGAAGAACAAAGAAAACGTAAAGCCATTGAAGCATGCAGCCAAACTAAAGCTAAAATGGATGAACTTGAAAACGA
ATTATCTAAAATAGTGGGGTTAGACGAACTTAAACTGCAACTCCGCAAATGGGCAAAGGGGATGCTCTTGGATGAGAGGCGTAGGGCCCT
AGGGCTTAAAGTCGGTGCAAGAAGACCACCCCATATGGCTTTCCTTGGAAACCCCGGAACAGGAAAAACTATGGTTGCTCGAATTCTTGG
AAAATTACTTCATATGGTTGGGATTCTTCCTACTGACAAGGTGACAGAGGTGCAGAGAACAGATCTGGTTGGTGAATTTGTTGGTCATAC
AGGGCCAAAGACGAGGAGAAAGATCCAAGAAGCTGAAGGGGGGATTCTTTTTGTTGATGAAGCCTATCGATTAATACCTATGCAGAAGTC
GGATGACAAGGACTATGGTTTGGAAGCGCTAGAGGAGATAATGTCTGTTATGGACAGCGGGAAAATTGTAGTAATTTTTGCAGGTTACAG
TGAACCAATGAAGCGCGTGATCACTTCTAATGAAGGTTTCTGTAGAAGAGTAACAAAGTTTTTCCATTTCGACAACTTTAGCTCTGAAGA
CCTTGCGAAGATTCTTCATCTTACAATGACCAGTCAAGCTGATCGTAGCTTGCTATATGGATTTAAGCTGCATCCTTCATGTACCGCTGA
TGCAGTTGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan