ESTScan Details for Unigene SGN-U196433

Score 
752
Direction 
Forward
Predicted Peptide Sequence 
MGGWAIAVHGGAGVDPNLPAERQEEAKHLLTRCLNIGISALRSSLPAIDVVELVVRELESDPLFNSGRGSALTANGTVEMEASIMDGDGR
RCGAVSGISTVKNPISLARLVMDKSPHSYLAFSGAEEFAKQQGVEMVDNDYFITEDNVGMLKLAKEANTILYDYRIPITGLESCAASVES
PIHMNGLPISVYAPETVGCVVVDGQGRCAAATSTGGLMNKMTGRIGDSPLIGAGTYAGELCGVSCTGEGEAIIRGTLPRDVAALMEYKES
GLQDAVDYVIKKRLDKGFAGLIGVSNKGEVAYG
Predicted Coding Sequence 
ATGGGTGGTTGGGCTATAGCGGTGCACGGTGGCGCTGGTGTGGATCCAAATCTCCCTGCTGAACGTCAAGAAGAAGCCAAACATCTCCTT
ACTCGTTGTCTTAATATTGGAATCTCTGCTCTTCGCTCTTCTCTCCCCGCCATTGATGTCGTTGAACTCGTCGTGAGGGAATTGGAAAGT
GATCCTTTATTCAATTCGGGTCGTGGATCTGCATTAACTGCAAATGGAACAGTGGAAATGGAGGCGAGCATTATGGACGGCGACGGTAGA
CGATGCGGCGCCGTTTCTGGTATATCCACCGTGAAAAATCCCATCTCTCTTGCTCGTCTCGTCATGGACAAATCCCCTCATTCCTACCTC
GCTTTCTCCGGCGCCGAAGAATTCGCCAAACAACAGGGTGTTGAGATGGTGGACAATGACTATTTCATCACCGAGGACAATGTTGGAATG
CTGAAACTAGCCAAAGAGGCTAACACCATTTTGTATGATTACAGAATTCCAATAACTGGATTGGAATCCTGTGCAGCATCTGTAGAGAGT
CCAATTCACATGAATGGTTTACCAATAAGCGTTTACGCCCCGGAGACTGTTGGGTGTGTGGTGGTTGATGGTCAAGGGAGGTGCGCCGCC
GCCACGTCAACCGGTGGTTTGATGAACAAAATGACCGGTAGAATCGGTGACTCACCATTGATTGGTGCTGGGACCTACGCAGGTGAACTA
TGTGGGGTGTCATGTACAGGTGAAGGAGAAGCCATCATACGTGGAACCCTACCACGTGACGTGGCAGCACTTATGGAGTATAAAGAATCG
GGCCTTCAAGATGCAGTGGACTATGTGATTAAGAAGAGATTGGATAAAGGGTTTGCTGGGCTAATTGGTGTGTCCAACAAAGGGGAAGTG
GCATATGGG\
Edits in Original Sequence 
CATAATAGAGAGAGAGAGAAAGAGGGAGAGTTAAATCAGCAAAAGAGGAGTTGTTAATTGTAGAAGA(5')ATGGGTGGTTGGGCTATAG
CGGTGCACGGTGGCGCTGGTGTGGATCCAAATCTCCCTGCTGAACGTCAAGAAGAAGCCAAACATCTCCTTACTCGTTGTCTTAATATTG
GAATCTCTGCTCTTCGCTCTTCTCTCCCCGCCATTGATGTCGTTGAACTCGTCGTGAGGGAATTGGAAAGTGATCCTTTATTCAATTCGG
GTCGTGGATCTGCATTAACTGCAAATGGAACAGTGGAAATGGAGGCGAGCATTATGGACGGCGACGGTAGACGATGCGGCGCCGTTTCTG
GTATATCCACCGTGAAAAATCCCATCTCTCTTGCTCGTCTCGTCATGGACAAATCCCCTCATTCCTACCTCGCTTTCTCCGGCGCCGAAG
AATTCGCCAAACAACAGGGTGTTGAGATGGTGGACAATGACTATTTCATCACCGAGGACAATGTTGGAATGCTGAAACTAGCCAAAGAGG
CTAACACCATTTTGTATGATTACAGAATTCCAATAACTGGATTGGAATCCTGTGCAGCATCTGTAGAGAGTCCAATTCACATGAATGGTT
TACCAATAAGCGTTTACGCCCCGGAGACTGTTGGGTGTGTGGTGGTTGATGGTCAAGGGAGGTGCGCCGCCGCCACGTCAACCGGTGGTT
TGATGAACAAAATGACCGGTAGAATCGGTGACTCACCATTGATTGGTGCTGGGACCTACGCAGGTGAACTATGTGGGGTGTCATGTACAG
GTGAAGGAGAAGCCATCATACGTGGAACCCTACCACGTGACGTGGCAcGCACTTATGGAGTATAAAGAATCGGGCCTTCAAGATGCAGTG
GACTATGTGATTAAGAAGAGATTGGATAAAGGGTTTGCTGGGCTAATTGGTGTGTCCAACAAAGGGGAAGTGGCATATGGG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan