ESTScan Details for Unigene SGN-U196470

Score 
653
Direction 
Forward
Predicted Peptide Sequence 
MAGSGEESKKMKLYSYWRSSCAFRVRIALNLKGLEYEYKAVDLLKGEQTDPEYLKLNPLGYVPTLVDGDAVIADSFAIIMYLEEKYPLQA
LLPQDCQKRAINYQAANIVSANIQPLQNLVILKYIQEKVGPNETTPWAQSHITKGFEALEKLLKDYAGKYATGDEVYMADLFLAPQIYAA
INRFEVDMNQFPTLLRVYKAYQELPAFQDAMPEKQPDPPAKAKNLRPSISLEVPFANH
Predicted Coding Sequence 
ATGGCAGGAAGTGGAGAGGAGTCAAAGAAGATGAAGCTCTATTCATATTGGAGGAGTTCATGTGCATTTCGTGTTCGAATAGCACTCAAT
TTGAAAGGATTGGAATATGAGTATAAAGCTGTTGACTTGCTTAAAGGAGAACAGACGGACCCTGAATACTTGAAGCTGAATCCCCTTGGA
TACGTGCCCACGCTGGTTGATGGAGATGCAGTAATTGCCGACTCTTTTGCCATCATAATGTATCTGGAAGAGAAGTATCCCCTGCAAGCA
TTGTTGCCGCAGGATTGTCAGAAAAGAGCAATCAACTATCAGGCAGCAAACATCGTTTCGGCAAACATTCAGCCTCTACAGAATCTTGTT
ATACTTAAGTACATCCAGGAAAAAGTTGGCCCTAATGAGACAACCCCTTGGGCTCAAAGTCATATAACAAAAGGCTTTGAAGCACTTGAA
AAGCTACTTAAGGATTACGCTGGAAAGTATGCAACAGGAGATGAAGTTTACATGGCTGACTTGTTTCTGGCACCTCAGATCTACGCGGCA
ATCAATCGTTTTGAAGTTGACATGAATCAATTCCCTACTCTGTTGAGGGTATATAAGGCTTACCAAGAGCTGCCCGCTTTCCAGGATGCT
ATGCCAGAAAAGCAACCTGATCCACCAGCTAAAGCXAAGAATCTGAGGCCATCCATCTCCTTGGAAGTTCCCTTTGCAAACCATTGA\
Edits in Original Sequence 
GTAGGACAGAACAATGTATTCAAGGGGGGCGGCGTAGAGGACGATTTCAATTTTGGTACTTACTACTACTTAAGCAGTTTGGTACTACGT
AGTATATTGTTCGGTATATTCTGTACTTGCTGTTAGTTCTTGAAGTCCCAGGAGTTGATT
(5')ATGGCAGGAAGTGGAGAGGAGTCAAA
GAAGATGAAGCTCTATTCATATTGGAGGAGTTCATGTGCATTTCGTGTTCGAATAGCACTCAATTTGAAAGGATTGGAATATGAGTATAA
AGCTGTTGACTTGCTTAAAGGAGAACAGACGGACCCTGAATACTTGAAGCTGAATCCCCTTGGATACGTGCCCACGCTGGTTGATGGAGA
TGCAGTAATTGCCGACTCTTTTGCCATCATAATGTATCTGGAAGAGAAGTATCCCCTGCAAGCATTGTTGCCGCAGGATTGTCAGAAAAG
AGCAATCAACTATCAGGCAGCAAACATCGTTTCGGCAAACATTCAGCCTCTACAGAATCTTGTTATACTTAAGTACATCCAGGAAAAAGT
TGGCCCTAATGAGACAACCCCTTGGGCTCAAAGTCATATAACAAAAGGCTTTGAAGCACTTGAAAAGCTACTTAAGGATTACGCTGGAAA
GTATGCAACAGGAGATGAAGTTTACATGGCTGACTTGTTTCTGGCACCTCAGATCTACGCGGCAATCAATCGTTTTGAAGTTGACATGAA
TCAATTCCCTACTCTGTTGAGGGTATATAAGGCTTACCAAGAGCTGCCCGCTTTCCAGGATGCTATGCCAGAAAAGCAACCTGATgCCAC
CAGCTAAAGCXAAGAATCTGAGGCCATCCATCTCCTTGGAAGTTCCCTTTGCAAACCATTGA\(3')AATAACTGCTGGACTCGTATTTT
GGCAGAATTGTTAGCTGGTTTCTGCACATTCTATTCTGAAAGGCGTTTGCCTTTTGTAAACTTCTTTTCTTTATGATGAATAAATTTGAG
AGATGTGTGGCGCTTCAGTCATGAGCTACTGAAGTACAGATGGTGAAAATGGTGTTGTACCTATGTTACGGAGCCTAGGATGAACATTCC
TCAGTCTATGTTGTGATTTGTGAGATATAATACAGTTGTCTGCATGTTGAAAAGAGAGGATGCTTCTGTTTTATTTTTTTGTTTGGTTAA
ATCGAGTACTTGTATTTGTATCATTCATCACCAACTCTGTAGCTTGCTGCAGTGTTGGGAGTTAATATGACGGAAAAAGATTCCTACGTT
AAAAAAAAAAAAAAAAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan