ESTScan Details for Unigene SGN-U196488

Score 
1294
Direction 
Forward
Predicted Peptide Sequence 
MSEGEKALPTASKDEKPVAAENKKSAESSSTEAPSGEGRTASTAAAGAGVQNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNQMAEQLQK
TFQGAAVEESVPNFDSQQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQLEERMARIKEDPSLKPILEEIESGGP
AAMMRYWNDQDVLKKIGEAMGFAAAGEGATSSEVPGTDETDEANEDESIVHQCASVGDAQGLX
Predicted Coding Sequence 
ATGTCTGAGGGAGAGAAGGCTTTGCCTACTGCATCAAAAGATGAGAAGCCTGTGGCAGCTGAGAATAAAAAATCTGCTGAGTCTTCCTCC
ACAGAAGCACCATCAGGAGAAGGGAGAACCGCCTCTACTGCTGCAGCTGGAGCTGGGGTCCAAAATCCCTTTGATTTCTCAGCCATGTCT
GGACTACTTAATGACCCAAGTATCAAAGAACTAGCTGAGCAGATAGCAAAAGACCCTGCATTTAATCAGATGGCAGAGCAGCTTCAGAAG
ACCTTTCAAGGTGCAGCAGTGGAAGAAAGTGTCCCCAACTTTGATAGCCAACAATACTACTCTACAATGCAACAGGTTATGCAAAATCCT
CAGTTTATGACCATGGCTGAGCGGCTTGGTAATGCATTGATGCAGGATCCATCTATGTCTGGCATGCTTGAGAGTTTGTCAAACCCTGCT
CAGAAGGAGCAACTTGAAGAACGGATGGCACGTATTAAAGAAGACCCATCACTGAAACCAATCTTGGAAGAGATAGAGAGCGGAGGACCA
GCTGCAATGATGAGGTATTGGAACGATCAAGATGTTCTGAAGAAGATTGGTGAAGCAATGGGTTTTGCTGCTGCAGGAGAGGGTGCTACC
TCATCTGAGGTACCTGGGACAGATGAAACAGATGAGGCAAATGAAGATGAATCTATTGTTCATCAGTGTGCTAGTGTTGGTGATGCACAG
GGCTTGAXX\
Edits in Original Sequence 
TTTTGCCTTTGATTTCCTGTACCCCCAAATCTCCCAAACCCCAAGATAAACTCCCACTTTTTTTTTTTTTTAACTTCTTCTGTAGCC(5')
ATGTCTGAGGGAGAGAAGGCTTTGCCTACTGCATCAAAAGATGAGAAGCCTGTGGCAGCTGAGAATAAAAAATCTGCTGAGTCTTCCTC
CACAGAAGCACCATCAGGAGAAGGGAGAACCGCCTCTACTGCTGCAGCTGGAGCTGGGGTCCAAAATCCCTTTGATTTCTCAGCCATGTC
TGGACTACTTAATGACCCAAGTATCAAAGAACTAGCTGAGCAGATAGCAAAAGACCCTGCATTTAATCAGATGGCAGAGCAGCTTCAGAA
GACCTTTCAAGGTGCAGCAGTGGAAGAAAGTGTCCCCAACTTTGATAGCCAACAATACTACTCTACAATGCAACAGGTTATGCAAAATCC
TCAGTTTATGACCATGGCTGAGCGGCTTGGTAATGCATTGATGCAGGATCCATCTATGTCTGGCATGCTTGAGAGTTTGTCAAACCCTGC
TCAGAAGGAGCAACTTGAAGAACGGATGGCACGTATTAAAGAAGACCCATCACTGAAACCAATCTTGGAAGAGATAGAGAGCGGAGGACC
AGCTGCAATGATGAGGTATTGGAACGATCAAGATGTTCTGAAGAAGATTGGTGAAGCAATGGGTTTTGCTGCTGCAGGAGAGGGTGCTAC
CTCATCTGAGGTACCTGGGACAGATGAAACAGATGAGGCAAATGAAGATGAATCTATTGTTCATCAGTGTGCTAGTGTTGGTGATGCACA
GGGCTTGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan