ESTScan Details for Unigene SGN-U196566

Score 
522
Direction 
Forward
Predicted Peptide Sequence 
ETRFTASSKKEELFPLLNFLDLSCVFFPTDALXAFIIVASQLAIMTPPIETPVKASVPQKFSIPPLNXKNTLFYDKEMVAAHPWHDLEIG
PDAPQIFNVVVEISKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPVLPGCFLRAKAIGLMPMIDQG
EKDDKIIAVCADDPEYKHYTDI
Predicted Coding Sequence 
XXGGAAACGCGTTTTACAGCTTCATCAAAGAAAGAAGAGCTCTTTCCTTTACTCAACTTTCTAGATCTGAGCTGTGTGTTTTTTCCCACC
GACGCTCTTXACGCCTTCATCATTGTTGCTTCTCAGCTAGCAATTATGACTCCACCCATCGAAACTCCAGTCAAGGCTTCAGTTCCACAG
AAGTTCTCCATTCCACCTCTTAATGAXAAGAATACTCTCTTCTATGACAAGGAGATGGTTGCAGCTCATCCTTGGCATGATCTCGAGATA
GGACCTGATGCCCCACAGATTTTTAATGTGGTGGTTGAGATCAGTAAGGGGAGCAAGGTGAAGTATGAACTTGATAAAAAAACTGGACTG
ATCAAGGTCGATCGTGTTCTTTACTCATCAGTTGTATACCCCCATAACTATGGGTTCATCCCTCGTACACTCTGTGAGGACAGTGACCCT
CTGGATGTCTTAGTCATCATGCAGGAGCCTGTTCTTCCTGGTTGCTTTCTTAGGGCTAAAGCAATTGGTCTTATGCCCATGATTGATCAG
GGAGAAAAGGATGACAAGATAATTGCTGTCTGTGCTGATGATCCTGAATATAAGCACTACACTGATATC\
Edits in Original Sequence 
(5')XXGGAAACGCGTTTTACAGCTTCATCAAAGAAAGAAGAGCTCTTTCCTTTACTCAACTTTCTAGATCTGAGCTGTGTGTTTTTTCC
CACCGACGCTCTTXACGCCTTCATCATTGTTGCTTCTCAGCTAGCAATTATGACTCCACCCATCGAAACTCCAGTCAAGGCTTCAGTTCC
ACAGAAGTTCTCCATTCCACCTCTTAATGAXAAGAATACTCTCTTCTATGACAAGGAGATcGGTTGCAGCTCATCCTTGGCATGATCTCG
AGATAGGACCTGATGCCCCACAGATTTTTAATGTGGTGGTTGAGATCAGTAAGGGGAGCAAGGTGAAGTATGAACTTGATAAAAAAACTG
GACTGATCAAGGTCGATCGTGTTCTTTACTCATCAGTTGTATACCCCCATAACTATGGGTTCATCCCTCGTACACTCTGTGAGGACAGTG
ACCCTCTGGATGTCTTAGTCATCATGCAGGAGCCTGTTCTTCCTGGTTGCTTTCTTAGGGCTAAAGCAATTGGTCTTATGCCCATGATTG
ATCAGGGAGAAAAGGATGACAAGATAATTGCTGTCTGTGCTGATGATCCTGAATATAAGCACTACACTGATATC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan