ESTScan Details for Unigene SGN-U196646

Score 
299
Direction 
Forward
Predicted Peptide Sequence 
MGVLDHISDMFDCSSEHSNHKRRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTIEPKQHKLTVVGYVDPEKVVARVAHRTGKKAE
IWPYVPYDVVAHPYAQGVYDKKAPAXVRGRDDFQTNQLARASSTEVRYTTAFSDENPAACXSHVNSNIVATMFT
Predicted Coding Sequence 
ATGGGTGTACTTGACCATATTTCTGACATGTTCGATTGCTCCTCTGAGCACTCCAACCACAAAAGACGCAAGCAATTACAGACAGTGGAG
ATAAAAGTGAAGATGGACTGTGAAGGTTGTGAGAGGAAAGTGCGAAGGTCTGTTGAGGGAATGAAAGGAGTTTCGTCCGTGACAATAGAG
CCCAAACAGCACAAGCTTACAGTAGTGGGCTATGTGGATCCAGAGAAAGTTGTGGCTCGTGTGGCCCATCGCACAGGTAAGAAGGCAGAG
ATTTGGCCCTATGTCCCATACGACGTTGTTGCTCATCCATATGCACAAGGTGTGTATGATAAGAAGGCTCCTGCTGXGGTACGTGGAAGA
GATGATTTCCAAACTAACCAGCTCGCGCGTGCTAGTTCTACTGAAGTTCGCTATACTACTGCCTTTAGCGATGAAAATCCTGCAGCCTGT
GXTAGTCATGTGAACTCAAATATTGTTGCTACTATGTTTACCTAA\
Edits in Original Sequence 
CACAAAACGTCAACAAATTAAGTGAGATATTTCTCTCATTTTAATCATTACCTCTTCTTCTTCTTCTTCTTTATTGCTCTCATCAAATAC
TCCCACAAGTAGTCCTTAATTTGTTGAAATCAGAAGAAA
(5')ATGGGTGTACTTGACCATATTTCTGACATGTTCGATTGCTCCTCTGA
GCACTCCAACCACAAAAGACGCAAGCAATTACAGACAGTGGAGATAAAAGTGAAGATGGACTGTGAAGGTTGTGAGAGGAAAGTGCGAAG
GTCTGTTGAGGGAATGAAAGGAGTTTCGTCCGTGACAATAGAGCCCAAACAGCACAAGCTTACAGTAGTGGGCTATGTGGATCCAGAGAA
AGTTGTGGCTCGTGTGGCCCATCGCACAGGTAAGAAGGCAGAGATTTGGCCCTATGTCCCATACGACGTTGTTGCTCATCCATATGCACA
AGGTGTGTATGATAAGAAGGCTCCTGCTGXGGTACGTGcGAAGAGATGATTTCCAAACTAACCAGCTCGCGCGTGCTAGTTCTACTGAAG
TTCGCTATACTACTGCCTTTAGCGATGAAAATCCTGCAGCCTGTGXTAGTCATGTGAACTCAAATATTGTTGCTACTATGTTTACCTAA\
(3')GTATGAAATCTTGTACCATAGTACTCGTTATTGTTAAATTTGTATTGGTTTTGTGGAGCTTGTACTTTAAGTTTTGATCGTGGTGC
TTTCTTCTGTTGAAGCTAAAGTTTTATCTATCATGCTTGTACTGCAGTGTTGTTAAATCGATGAATATTCTGTTCTTGAAAAAAAAAAAA
AAAAAACTCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan