ESTScan Details for Unigene SGN-U196687

Score 
621
Direction 
Forward
Predicted Peptide Sequence 
MALSQFLFFSFLFIFFNLSLPNEIDVHDLLPTFKLPKGLLPNNVESYTISPKDSSFTVQLTHPCYVEFPNQLVYYQKDIKGKLSYGEVSD
ISGIQAKKLFVWVPVTGIDVDEQFHMIEFHVGFLSEKLPAEVFENIPTCKNMGSQDSPFASI
Predicted Coding Sequence 
ATGGCCTTGTCACAATTCTTGTTCTTCTCTTTCCTTTTCATCTTCTTCAACCTTTCACTTCCAAATGAAATTGATGTCCATGATCTCCTT
CCTACTTTCAAACTTCCAAAAGGTCTTCTCCCAAACAATGTTGAATCCTACACTATTTCCCCTAAAGACAGCTCTTTTACTGTCCAACTT
ACACATCCATGTTATGTGGAGTTTCCAAATCAACTTGTTTACTACCAAAAAGATATCAAAGGGAAATTGAGTTATGGGGAAGTCTCTGAT
ATCTCTGGGATACAAGCTAAAAAATTGTTTGTTTGGGTGCCTGTAACTGGGATTGATGTTGATGAGCAGTTTCATATGATTGAGTTTCAT
GTTGGGTTTTTGTCTGAAAAGTTGCCCGCTGAGGTATTTGAGAATATTCCCACTTGTAAGAATATGGGGTCTCAAGATTCTCCCTTTGCT
TCAATCTGA\
Edits in Original Sequence 
GTCTCTACCTCTACA(5')ATGGCCTTGTCACAATTCTTGTTCTTCTCTTTCCTTTTCATCTTCTTCAACCTTTCACTTCCAAATGAAAT
TGATGTCCATGATCTCCTTCCTACTTTCAAACTTCCAAAAGGTCTTCTCCCAAACAATGTTGAATCCTACACTATTTCCCCTAAAGACAG
CTCTTTTACTGTCCAACTTACACATCCATGTTATGTGGAGTTTCCAAATCAACTTGTTTACTACCAAAAAGATATCAAAGGGAAATTGAG
TTATGGGGAAGTCTCTGATATCTCTGGGATACAAGCTAAAAAATTGTTTGTTTGGGTGCCTGTAACTGGGATTGATGTTGATGAGCAGTT
TCATATGATTGAGTTTCATGTTGGGTTTTTGTCTGAAAAGTTGCCCGCTGAGGTATTTGAGAATATTCCCACTTGTAAGAATATGGGGTC
TCAAGATTCTCCCTTTGCTTCAATCTGA\(3')TGAGGTCAAAGTTGTAATCTTTATAATGTCTAAATCCAATAATAATTGTACTTGGGT
TCATTGATGTTGGTTTATATTTTGGTTTTGCACTTTTGCTTGTCCAGTAGTTTGAGACAATCGTGGTGTGATCTTTGAATAAATTGCAAA
ATTATCCATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan