ESTScan Details for Unigene SGN-U196696

Score 
207
Direction 
Forward
Predicted Peptide Sequence 
SKKMSGGGMESMTQPTPPGMGGGDRVMNSQHGGDRCGYDFHMPLHYPRYTRAEYEVMPEWKLDCLLTQYGLPINGDVNQKRKFAMGAFLW
TY
Predicted Coding Sequence 
XXATCCAAGAAAATGAGTGGAGGTGGAATGGAGTCGATGACACAGCCAACTCCGCCCGGTATGGGCGGAGGTGACCGTGTAATGAACAGC
CAGCACGGCGGAGACCGGTGTGGCTACGACTTTCACATGCCGTTGCATTACCCAAGATACACAAGAGCTGAATATGAGGTTATGCCAGAA
TGGAAACTGGATTGTTTGCTTACTCAATATGGACTTCCTATTAATGGAGATGTTAATCAAAAGAGGAAGTTTGCTATGGGAGCCTTTCTC
TGGACTTATTAA\
Edits in Original Sequence 
(5')XXATCCAAGAAAATGAGTGGAGGTGGAATGGAGTCGATGACACAGCCAACTCCGCCCGGTATGGGCGGAGGTGACCGTGTAATGAA
CAGCCAGCACGGCGGAGACCGGTGTGGCTACGACTTTCACATGCCGTTGCATTACCCAAGATACACAAGAGCTGAATATGAGGTTATGCC
AGAATGGAAACTGGATTGTTTGCTTACTCAATATGGACTTCCTATTAATGGAGATGTTAATCAAAAGAGGAAGTTTGCTATGGGAGCCTT
TCTCTGGACTTATTAA\(3')TTATAATTATGACTAGCTAAATCTCCTCTTCTCTATCAGTTAATCGGTTTGTTAATTGTGTTGTGTGTG
TATAAGTTAAAACTCTTTTTGTAGTATGTAAAATGGTTCATCATGGTTTCTTTTCTATGAATCTAATACTACTAAGTTTTGTTATCAAAA
AAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan