ESTScan Details for Unigene SGN-U196703

Score 
469
Direction 
Forward
Predicted Peptide Sequence 
MSQQLIESHRENAEVYTDPVVCKQKTLQLLKEINMPNGLLPLEDIFEVGRNVETGFVWLKQKKAKEHKFKKIGKLVWYDTEVTAFVEDRR
MKKVTGVKSKEILIWVALTDISITDPEGKKITFGTPTGISRSFPVSAFEEEEEKEEEKKXKGGRSEGEGVFX
Predicted Coding Sequence 
ATGTCTCAGCAACTCATCGAAAGCCACCGTGAAAATGCGGAAGTGTACACAGATCCAGTAGTCTGCAAGCAAAAAACCCTCCAACTTTTA
AAGGAAATCAACATGCCGAATGGCCTTCTCCCTCTAGAAGACATCTTTGAAGTTGGCCGGAACGTGGAAACCGGGTTCGTTTGGCTGAAG
CAGAAGAAGGCGAAAGAGCACAAGTTTAAGAAGATTGGGAAGCTTGTATGGTACGACACTGAAGTGACGGCGTTTGTGGAGGATCGAAGG
ATGAAGAAGGTAACTGGTGTCAAGAGTAAGGAGATACTTATCTGGGTTGCGCTTACGGATATCTCGATAACTGACCCGGAGGGTAAGAAA
ATTACCTTTGGTACCCCTACTGGAATTTCTAGGTCTTTTCCTGTTTCTGCTTTTGAGGAGGAGGAAGAGAAGGAAGAAGAGAAGAAGXTG
AAGGGGGGAAGGAGTGAAGGTGAAGGGGTATTTTXX\
Edits in Original Sequence 
CTCAAGTACTCTCTCCTCTTTGAGAATTGAATTCTCTTCCATTTTCCTGAGAAAAATCCGAAA(5')ATGTCTCAGCAACTCATCGAAAG
CCACCGTGAAAATGCGGAAGTGTACACAGATCCAGTAGTCTGCAAGCAAAAAACCCTCCAACTTTTAAAGGAAATCAACATGCCGAATGG
CCTTCTCCCTCTAGAAGACATCTTTGAAGTTGGCCGGAACGTGGAAACCGGGTTCGTTTGGCTGAAGCAGAAGAAGGCGAAAGAGCACAA
GTTTAAGAAGATTGGGAAGCTTGTATGGTACGACACTGAAGTGACGGCGTTTGTGGAGGATCGAAGGATGAAGAAGGTAACTGGTGTCAA
GAGTAAGGAGATACTTATCTGGGTTGCGCTTACGGATATCTCGATAACTGACCCGGAGGGTAAGAAAATTACCTTTGGTACCCCTACTGG
AATTTCTAGGTCTTTTCCTGTTTCTGCTTTTGAGGAGGAGGAAGAGAAGGAAGAAGAGAAGAAGXTGAAGGGGGGAAGGAGTGAAGGTGA
AGGGGTATTTTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan