ESTScan Details for Unigene SGN-U196821

Score 
493
Direction 
Forward
Predicted Peptide Sequence 
AKGRGTNIGNPNXKVFVEKMSALDAARAELALAVLYLNKAEARDKICRAIQYGSKFLSNGEPGTAQNVDKSTSLARKVFRLFKFINDLHG
LISPPAPGTPIPAHLAGKVKKCIAINFLVSGSIVWLGRTGIYKNKEAQSYLAGSLSFVGWVPRSXTTLVEIGELGRLSASMKKLEKELKN
SNKYKDEQYQSKLQKSNERSLALIKAGIDIVVAVGLLQLAPKKVTPRVTGAFGFVSXLDIMLSVAPSTAKGQDIVKGSDAVD
Predicted Coding Sequence 
GCAAAAGGCCGTGGCACAAATATCGGTAACCCAAATXTCAAAGTATTTGTAGAGAAAATGAGTGCCTTGGATGCAGCCAGAGCAGAGCTT
GCCCTTGCAGTCTTGTACTTAAACAAAGCAGAAGCAAGGGACAAGATATGCAGGGCAATACAGTATGGTTCAAAATTCCTGAGTAATGGA
GAGCCTGGCACTGCTCAAAATGTTGACAAATCAACTAGCTTAGCAAGGAAAGTATTCCGTCTTTTCAAGTTTATCAATGATCTCCATGGA
CTTATTAGTCCACCTGCCCCAGGAACCCCAATTCCXGCTCATCTTGCTGGGAAAGTCAAAAAATGCATTGCTATCAACTTTCTTGTTTCT
GGATCAATTGTGTGGCTTGGAAGGACAGGGATTTACAAGAACAAAGAAGCACAGAGTTACTTGGCAGGATCTCTCTCTTTTGTTGGATGG
GTTCCTCGATCTGXTACTACCTTAGTGGAGATTGGGGAGCTCGGGAGACTTTCAGCATCAATGAAAAAGCTGGAGAAGGAACTCAAGAAT
AGCAACAAATACAAGGATGAGCAATACCAGAGTAAGCTTCAGAAGTCAAATGAGAGGTCTCTAGCCCTTATTAAAGCAGGCATTGATATA
GTAGTTGCTGTCGGATTGCTCCAATTGGCACCTAAGAAAGTCACTCCTCGCGTAACAGGAGCCTTTGGATTTGTTAGCXTCCTTGATATC
ATGTTATCAGTTGCTCCCAGCACCGCCAAAGGCCAAGACATCGTGAAAGGCTCTGATGCCGTTGAT\
Edits in Original Sequence 
(5')GCAAAAGGCCGTGGCACAAATATCGGTAACCCAAATXTCAAAGTATTTGTAGAGtAAAATGAGTGCCTTGGATGCAGCCAGAGCAG
AGCTTGCCCTTGCAGTCTTGTACTTAAACAAAGCAGAAGCAAGGGACAAGATATGCAGGGCAATACAGTATGGTTCAAAATTCCTGAGTA
ATGGAGAGCCTGGCACTGCTCAAAATGTTGACAAATCAACTAGCTTAGCAAGGAAAGTATTCCGTCTTTTCAAGTTTATCAATGATCTCC
ATGGACTTATTAGTCCACCTGCCCCAGGAACCCCAATTCCXGCTCATCTTGCTGGGAAAGTCAAAAAATGCATTGCTATCAACTTTCTTG
TTTCTGGATCAAtTTGTGTGGCTTGGAAGGACAGGGATTTACAAGAACAAAGAAcGCACAGAGTTACTTGGCAGGATCTCTCTCTTTTGT
TGGATGGGTTCCTCGATCTGXTACTACCTTAGTGGAGATTGGGGAGCTCGGGAGACTTTCAGCATCAATGAAAAAGCTGGAGAAGGAACT
CAAGAATAGCAACAAATACAAGGATGAGCAATACCAGAGTAAGCTTCAGAAGTCAAATGAGAGGTCTCTAGCCCTTATTAAAGCAGGCAT
TGATATAGTAGTTGCTGTCGGATTGCTCCAATTGGCACCTAAGAAAGTCACTCCTCGCGTAACAGGAGCCTTTGGATTTGTTAGCXTCCT
TGATATCATGTTATCAGTTGCTCCCAGCACCGCCAAAGGCCAAGACATCGTGAAAGGCTCTGATGCCGTTGAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan