ESTScan Details for Unigene SGN-U196936

Score 
844
Direction 
Forward
Predicted Peptide Sequence 
TSNPKASSPQVKMRALLGKLAKAAPVAFSGASKSNFADPRFPFGAIAAVAGCVSYYYCYSSPNLVYSEQINEDSGKKIALNPDKWIEFKL
EDRASVSHNSHLFRFSFDPSSKLGLDIASCILTRAPMGENAEGKPKYAIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFARLKPGDVLQ
VKGPIEKLRYSPNLKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQVSLVYANLSPDDILLKKKLDVLAATHPNLKVFYTVDNPTNDWRG
SIGYVSKDMIIKGLPPPGDDTLILVCGPPGMIKHLSGEKPNPREQGELTGLLKDXGLYGEHGLQILMGLSTMGFLTFLLNKKL
Predicted Coding Sequence 
XCTACATCAAATCCTAAAGCTTCTTCTCCACAGGTGAAAATGAGAGCGTTGTTGGGTAAGCTAGCGAAGGCTGCACCCGTGGCGTTCAGT
GGCGCTTCCAAATCAAATTTTGCTGATCCTCGCTTTCCATTTGGAGCTATTGCAGCCGTTGCTGGCTGCGTCTCTTATTATTACTGCTAT
TCTTCTCCTAATTTGGTGTACTCGGAGCAAATCAATGAAGATTCTGGTAAAAAAATTGCTCTAAATCCTGATAAGTGGATTGAATTTAAG
CTGGAAGATCGAGCATCAGTTAGCCACAACAGTCATCTGTTCAGGTTTTCGTTTGATCCTTCTTCAAAGTTAGGTCTTGATATTGCATCT
TGCATTCTTACGAGGGCACCAATGGGAGAAAATGCTGAGGGAAAACCAAAATACGCCATTCGGCCTTATACTCCTATATCCGATCCAGAA
GCCAAGGGATACTTTGATTTATTAATTAAGGTTTATCCAGAAGGGAAAATGAGCCAGCATTTTGCAAGACTGAAGCCGGGTGATGTACTT
CAAGTGAAAGGGCCTATTGAGAAATTGCGTTACAGTCCAAACTTGAAGAAACATATAGGCATGATTGCAGGGGGCAGCGGCATCACTCCA
ATGCTCCAGGTGATAGAGGCCATTCTTAAGAACCCTGATGATAATACTCAGGTCTCGTTAGTTTATGCTAATCTGTCACCTGATGACATA
CTGCTAAAGAAGAAACTTGATGTACTTGCAGCCACCCATCCAAATCTCAAGGTATTTTACACTGTAGATAACCCAACGAATGATTGGAGA
GGCAGCATAGGTTACGTATCGAAGGACATGATTATAAAAGGACTACCTCCGCCTGGTGATGATACACTTATCCTTGTATGTGGGCCTCCT
GGGATGATAAAACATTTATCTGGCGAAAAGCCAAATCCTCGTGAGCAAGGCGAGTTAACTGGACTACTCAAGGATGXTGGGCTTTACGGA
GAACATGGTTTACAAATTTTAATGGGTTTGTCAACTATGGGGTTCCTTACCTTTTTATTGAATAAAAAGCTT\
Edits in Original Sequence 
(5')XCTACATCAAATCCTAAAGCTTCTTCTCCACAGGTGAAAATGAGAGCGTTGTTGGGTAAGCTAGCGAAGGCTGCACCCGTGGCGTT
CAGTGGCGCTTCCAAATCAAATTTTGCTGATCCTCGCTTTCCATTTGGAGCTATTGCAGCCGTTGCTGGCTGCGTCTCTTATTATTACTG
CTATTCTTCTCCTAATTTGGTGTACTCGGAGCAAATCAATGAAGATTCTGGTAAAAAAATTGCTCTAAATCCTGATAAGTGGATTGAATT
TAAGCTGGAAGATCGAGCATCAGTTAGCCACAACAGTCATCTGTTCAGGTTTTCGTTTGATCCTTCTTCAAAGTTAGGTCTTGATATTGC
ATCTTGCATTCTTACGAGGGCACCAATGGGAGAAAATGCTGAGGGAAAACCAAAATACGCCATTCGGCCTTATACTCCTATATCCGATCC
AGAAGCCAAGGGATACTTTGATTTATTAATTAAGGTTTATCCAGAAGGGAAAATGAGCCAGCATTTTGCAAGACTGAAGCCGGGTGATGT
ACTTCAAGTGAAAGGGCCTATTGAGAAATTGCGTTACAGTCCAAACTTGAAGAAACATATAGGCATGATTGCAGGGGGCAGCGGCATCAC
TCCAATGCTCCAGGTGATAGAGGCCATTCTTAAGAACCCTGATGATAATACTCAGGTCTCGTTAGTTTATGCTAATCTGTCACCTGATGA
CATACTGCTAAAGAAGAAACTTGATGTACTTGCAGCCACCCATCCAAATCTCAAGGTATTTTACACTGTAGATAACCCAACGAATGATTG
GAGAGGCAGCATAGGTTACGTATCGAAGGACATGATTATAAAAGGACTACCTCCGCCTGGTGATGATACACTTATCCTTGTATGTGGGCC
TCCTGGGATGATAAAACATTTATCTGGCGAAAAGCCAAATCCTCGTGAGCAAGGCGAGTTAACTGGACTACTCAAGGATGXTGGGCTTTA
CGGAGAACATGGTTTACAAATTTTAATGGGTTTGTCAACTATGGGGTTCCTTACCTTTTTATTGAATAAAAAGCTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan