ESTScan Details for Unigene SGN-U197053

Score 
179
Direction 
Forward
Predicted Peptide Sequence 
MEDRRQRFRILSINSKRNYSQPPPPPPPAVNAPLLYTFPSVGGKWSSARFATAILFGVNSAIGYMLMLAVMSFNGGVFIAVVVGLGIGYL
FFGTVMKMMSSLIIRVPVLDVD
Predicted Coding Sequence 
ATGGAAGATCGTCGTCAGCGATTCAGAATCCTCTCTATAAATTCCAAGAGGAATTACTCTCAGCCTCCGCCTCCGCCTCCCCCCGCTGTC
AATGCTCCCCTTCTTTACACCTTCCCGTCGGTTGGCGGTAAGTGGAGTTCGGCCAGATTTGCTACGGCGATTCTATTTGGAGTCAATTCT
GCAATTGGATATATGCTTATGCTGGCTGTTATGTCGTTTAATGGCGGAGTTTTTATCGCGGTTGTTGTGGGTTTGGGGATCGGGTATTTG
TTCTTTGGAACGGTGATGAAAATGATGTCGTCGTTGATAATCCGTGTGCCTGTGCTTGATGTTGATTAA\
Edits in Original Sequence 
TATATATTATCATCATTGTCAACTCACACGCTACCTAGCTTATCATCATCCAATCGAAAGGCCATACTTCCCCCAACCAAATCAACAAAA
CTCCCATCTCATCTTCTCCCCAAAACCTAAATAAATCTTCAAAGCAAGAAAAAATGATGCACATGACCTTTTATTGGGGTAAAAAAGTTA
CCCTACTATTCGATTTCTGGCGAACGGATTCATGGACTAGCTACGCAATCGCTTTGCTCGCTTGTTTTATCTTCTCCTTGTTTTATCAAT
AC
(5')ATGGAAGATCGTCGTCAGCGATTCAGAATCCTCTCTATAAATTCCAAGAGGAATTACTCTCAGCCTCCGCCTCCGCCTCCCCCC
GCTGTCAATGCTCCCCTTCTTTACACCTTCCCGTCGGTTGGCGGTAAGTGGAGTTCGGCCAGATTTGCTACGGCGATTCTATTTGGAGTC
AATTCTGCAATTGGATATATGCTTATGCTGGCTGTTATGTCGTTTAATGGCGGAGTTTTTATCGCGGTTGTTGTGGGTTTGGGGATCGGG
TATTTGTTCTTTaGGAACGGTGATGAAAATGATGTCGTCGTTGATAATCCGTGTGCCTGTGCTTGATGTTGATTAA\(3')TGGATTTGG
TTGTTGCTTTTAATAGTGAAAATTGATAGTGGAAGTGTTTTTTTTTTTTCTTTCCCTTTTTTTTTTTGGGTTTTAGGTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan