ESTScan Details for Unigene SGN-U197057

Score 
389
Direction 
Forward
Predicted Peptide Sequence 
HGNLKSSNVLLGSDFEACLTDYSLIVLADISSDDDPDSARYKAPEVRKSARRATPGSDVYAYGILLLELLTGKPPSQHPHLSPPDVPDWV
RAMREDDNEEDRWLAMLVDLASICSLTSPEQRPTMRQILKMIQDIKDNAMVENNKRDAHTGYXVASFCIAITPLTGGEGAWSIEVSVTPE
TNLDSEIIMFPTWQSAIVDNISATQMDQIVSAXNGACTFTAQQ
Predicted Coding Sequence 
XCTCATGGCAACTTGAAATCCTCCAACGTCCTTCTAGGATCTGATTTTGAAGCCTGTCTAACAGACTACTCCCTCATCGTGCTTGCAGAT
ATTTCCTCGGATGATGATCCTGATTCAGCACGCTATAAAGCACCAGAAGTGCGCAAATCTGCACGAAGAGCCACTCCAGGGTCTGATGTA
TATGCCTATGGCATTCTGTTATTAGAGCTTTTAACGGGTAAACCTCCATCTCAGCATCCACATCTATCTCCCCCTGATGTGCCGGATTGG
GTTAGAGCTATGAGGGAGGATGATAATGAGGAGGACAGATGGCTTGCGATGCTAGTTGACCTTGCTAGTATATGTAGCTTGACATCACCA
GAACAGAGACCAACAATGAGGCAAATCTTGAAAATGATTCAAGATATAAAGGATAACGCAATGGTGGAGAATAACAAAAGGGATGCACAT
ACTGGATACXTCGTAGCTTCTTTTTGTATTGCAATTACTCCATTAACCGGCGGCGAGGGTGCATGGTCAATTGAAGTAAGTGTCACACCT
GAAACAAATTTGGATAGTGAAATCATTATGTTTCCCACTTGGCAAAGTGCCATTGTTGACAACATATCTGCTACTCAGATGGACCAAATA
GTATCAGCTGXTAATGGTGCTTGTACCTTTACTGCTCAGCAGTAA\
Edits in Original Sequence 
(5')XCTCATGGCAACTTGAAATCCTCCAACGTCCTTCTAGGATCTGATTTTGAAGCCTGTCTAACAGACTACTCCCTCATCGTGCTTGC
AGATATTTCCTCGGATGATGATCCTGATTCAGCACGCTATAAAGCACCAGAAGTGCGCAAATCTGCACGAAGAGCCACTCCAGGGTCTGA
TGTATATGCCTATGGCATTCTGTTATTAGAGCTTTTAACGGGTAAACCTCCATCTCAGCATCCACATCTATCTCCCCCTGATGTGCCGGA
TTGGGTTAGAGCTATGAGGGAGGATGATAATGAGGAGGACAGATGGCTTGCGATGCTAGTTGACCTTGCTAGTATATGTAGCTTGACATC
ACCAGAACAGAGACCAACAATGAGGCAAATCTTGAAAATGATTCAAGATATAAAGGATAACGCAATGGTGGAGAATAACAAAAGGGATGC
ACATACTGGATACXTCGTAGCTTCTTTTTGTATTGCAATTACTCCATTAACCGGCGGCGAGGGTGCATGGTCAATTGtAAGTAAGTGTCA
CACCTGAAACAAATTTGGATAGTGAAATCATTATGTTTCCCACTTGGCAAAGTGCCATTaGTTGACAACATATCTGCTACTCAGATGGAC
CAAATAGTATCAGCTGXTAATGGTGCTTGTACCTTTACTGCTCAGCAGTAA\(3')ACAGCATAAAACTGACAGTTTTAGGTCTATCTGC
TAGAACTTGGTCAACTTAGTCACTGAAGATTTGACACTTTTTTTGGCCACACAAACATATATGGTGCTGATATTTTTAGGGAGAATTGTT
TACAGCTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan