ESTScan Details for Unigene SGN-U197114

Score 
560
Direction 
Forward
Predicted Peptide Sequence 
VPEXNSYIPKLEPFSRTRFDRAVKDPPLIEKSENELADYCSVLEGDDSYSCWQAYFELKDLEKEEPKEEVERLILQAGGVKTLISCLHGI
SEMHKARNRSKESAKAMNLEAEGARHCPIPDGLPKTREELEEEEKARMPDSPYTKLLRARGTHPVWYSTTLDY
Predicted Coding Sequence 
XTTGTTCCAGAAGXTAATTCTTACATACCAAAGCTGGAGCCTTTTAGCAGAACCAGGTTTGATAGAGCTGTTAAAGATCCCCCTTTGATT
GAAAAATCAGAAAATGAACTTGCTGATTATTGTTCTGTTCTAGAAGGGGATGATTCGTATAGCTGCTGGCAGGCCTATTTTGAACTCAAA
GATCTTGAAAAAGAAGAACCTAAGGAGGAGGTAGAGAGGCTAATACTTCAAGCAGGGGGCGTAAAAACTCTCATTAGCTGCTTGCATGGA
ATTTCAGAAATGCACAAAGCCAGAAATAGAAGCAAAGAATCAGCCAAAGCTATGAATCTTGAGGCAGAAGGGGCAAGACATTGTCCTATA
CCCGATGGATTGCCAAAGACAAGAGAAGAGCTTGAGGAGGAGGAGAAAGCTAGAATGCCAGATTCACCCTATACCAAACTGCTCAGAGCT
AGAGGAACACACCCTGTTTGGTACTCGACTACACTTGATTATTGA\
Edits in Original Sequence 
(5')XTTGTTCCAGAAGXTAATTCTTACATACCAAAGCTGGAGCCTTTTAGCAGAACCAGGTTTGATAGAGCTGTTAAAGATCCCCCTTT
GATTGAAAAATCAGAAAATGAACTTGCTGATTATTGTTCTGTTCTAGAAGGGGATGATTCGTATAGCTGCTGGCAGGCCTATTTTGAACT
CAAAGATCTTGAAAAAGAAGAACCTAAGGAGGAGGTAGAGAGGCTAATACTTCAAGCAGGGGGCGTAAAAACTCTCATTAGCTGCTTGCA
TGGAATTTCAGAAATGCACAAAGCCAGAAATAGAAGCAAAGAATCAGCCAAAGCTATGAATCTTGAGGCAGAAGGGGCAAGACATTGTCC
TATACCCGATGGATTGCCAAAGACAAGAGAAGAGCTTGAGGAGGAGGAGAAAGCTAGAATGCCAGATTCACCCTATACCAAACTGCTCAG
AGCTAGAGGAACACACCCTGTTTGGTACTCGACTACACTTGATTATTGA\(3')TATGGAGGTTCATGCAGGGCTTGGTCTTTGGAGCTT
CAGAGTAATAAGGTCAAGGAATGGAGTTGAATAGTGCATCTTTGGCCAATGTTGTAAAATTTCTGGTGATGTAATGTTAAAGCCTGTGTG
GATGTTGTCGCGTATTTTTGTTAGTGTAGTTTATGGGCAAGTTTAGGGGTTGCCATTTGTTCTGAATGTAAATAAATATGGTTTGTTCCG
CGTATATTCTAATATCAATGAAGTTTCTACAAAAAAAAAAAAAAAAAAAAAACTCGAGACTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan