ESTScan Details for Unigene SGN-U197181

Score 
218
Direction 
Forward
Predicted Peptide Sequence 
KKIVAGATEHSQYNPEACTSPSPILFLFLWLKIVEKGSEETQEPLVLRSMKEXLSSMSRKSVAAHPWHDLEIGPGAPAIFNCVVEIPKGS
KVKYELDKASGLIKVDRILYSSVVYPHNYGFIPRTLCEDSDPMDXPSADAGLLR
Predicted Coding Sequence 
AAGAAAATAGTAGCTGGAGCAACTGAGCATAGTCAGTACAATCCAGAAGCTTGTACTTCTCCTTCACCCATTCTCTTTCTTTTTCTATGG
CTGAAAATAGTGGAAAAGGGCTCGGAAGAAACTCAGGAACCACTCGTGTTGCGCTCAATGAAAGAAXTTCTCTCCTCCATGTCACGGAAA
TCTGTTGCTGCTCATCCGTGGCATGACTTAGAGATCGGGCCAGGTGCACCCGCAATCTTCAACTGTGTGGTTGAAATACCCAAAGGCAGC
AAAGTGAAGTATGAGCTTGACAAAGCAAGTGGCCTTATAAAGGTTGACCGCATACTGTACTCATCAGTTGTTTATCCACACAACTATGGT
TTCATCCCAAGAACCCTTTGTGAAGACAGTGATCCAATGGATGXTCCTAGTGCTGATGCAGGTTTGCTCCGT\
Edits in Original Sequence 
(5')AAGAAAATAGTAGCTGtGAGCAACTGAGCATAGTCtAGTACAATCCAGAAGCTTGTACTTCTCCTTCACCCATTCTCTTTCTTTTT
CTATGGCTGAAAATAGTGGAAAAGGGCTCGGAAGAAACTCAGGAACCACTCGTGTTGCGCTCAATGAAAGAAXTTCTCTCCTCCATGTCA
CGGAAATCTGTTGCTGCTCATCCGTGGCATGACTTAGAGATCGGGCCAGGTGCACCCGCAATCTTCAACTGTGTGGTTGAAATACCCAAA
GGCAGCAAAGTGAAGTATGAGCTTGACAAAGCAAGTGGCCTTATAAAGGTTGACCGCATACTGTACTCATCAGTTGTTTATCCACACAAC
TATGGTTTCATCCCAAGAACCCTTTGTGAAGACAGTGATCCAATGGATGXTCCTAGTGCTGATGCAGGTTTGCTCCGT\(3')TTACACA
CAATATACATGCACGTACACACACACATCTTCCTTAGGCCCAATCTTGCATTAGCTGTCTCAATGTAAGCTCTCTCTTGGGTACTCTTAC
ATCCATCCATGTGTTGTATAGGAACCTGTGTTACCTAGTACCTTTCTTCGTGCTCGTGCAATTGGATTGATGCCTATGATTGATCAGGTA
AGGTTTTTCAATAGAGTAAACTTTCTGCCAACTGTACTTTAGGACATGGTGAAAATTGCTGGAGAAAACACCATTTGCTTATAATTTTTT
GAAATAGTTCTTTTTGTCTCCTTAAGTTTTATCAAAGACCTATTTNTAACCCTTCAGTGCCCTATAATACTTGATAAGAATATCATTGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan