Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U197186

Score 
574
Direction 
Forward
Predicted Peptide Sequence 
YKDDLLVDLESRTPSRFLLWKSERILQSEVEXARSHTGNIYNEQQLVANPFSSGGIPSEIAENLKDFFPEDGDLSYEEVLLQQETVYLSL
QANGKNKNITSEYGQTSSGHQLSVQKSDSSQSLESQLALDEALARSLQLGDNFEDFCRDELNSIVAGIGESPPRESPPVRVQAENPNTRI
QDDIDPDGMTYEELQSLGEAVGQQSRGLSQDLIRRLPTFKYKTGFFSKKKKMGECVICYAAYRSGDMLTTLPCAHMFHSECINRWLKERK
NCPLCYEEVKDDDFPGNVKALVAQLDLPSNSLFAHVERIGAL
Predicted Coding Sequence 
XGTTACAAAGATGACCTGCTAGTAGACTTGGAGTCAAGAACCCCATCTCGTTTTCTTCTCTGGAAAAGTGAAAGGATCCTGCAGTCTGAA
GTAGAAXTAGCGCGAAGTCATACCGGAAACATTTACAATGAGCAACAGCTTGTTGCAAACCCATTTTCAAGTGGTGGAATCCCATCGGAG
ATTGCTGAGAATTTAAAAGATTTTTTTCCTGAGGACGGTGATTTGAGTTATGAAGAAGTTCTTTTGCAACAGGAAACTGTTTACTTATCA
CTTCAAGCAAATGGGAAAAACAAAAATATTACCTCTGAATATGGCCAAACCAGTAGCGGGCATCAGTTATCAGTACAAAAGAGTGATTCT
TCTCAAAGCCTTGAATCACAATTAGCTTTGGATGAAGCTTTAGCTAGATCGTTGCAGTTAGGGGATAATTTTGAGGATTTCTGTAGAGAT
GAGCTTAATTCTATTGTAGCTGGCATCGGGGAATCACCTCCTAGAGAATCACCTCCGGTTAGGGTGCAGGCTGAGAATCCAAACACGAGG
ATACAAGATGATATTGATCCAGATGGTATGACCTATGAGGAATTGCAGTCTTTAGGGGAAGCTGTTGGCCAGCAGAGCAGAGGGCTTTCA
CAAGACCTCATACGTCGTTTACCAACTTTCAAATATAAGACTGGATTCTTTTCAAAGAAAAAGAAAATGGGAGAGTGTGTTATATGCTAT
GCTGCATACAGAAGTGGAGATATGTTGACCACTTTACCTTGTGCACACATGTTTCATTCAGAATGTATTAACCGCTGGCTAAAAGAAAGA
AAGAACTGCCCCCTCTGTTATGAAGAGGTGAAAGATGATGACTTCCCAGGAAACGTCAAAGCXCTTGTTGCTCAATTGGATCTGCCTTCA
AATTCACTTTTCGCACATGTAGAGAGAATCGGCGCCCTTTAA\
Edits in Original Sequence 
(5')XGTTACAAAGATGACCTGCTAGTAGACTTGGAGTCAAGAACCCCATCTCGTTTTCTTCTCTGGAAAAGTGAAAGGATCCTGCAGTC
TGAAGTAGAAXTAGCGCGAAGTCATACCGGAAACATTTACAATGAGCAACAGCTTGTTGCAAACCCATTaTTCAAGTGGTGGAATCCCAT
CGGAGATTGCTGAGAATTTAAAAGATTTTTTTCCTGAGGACGGTGATTTGAGTTATGAAGAAGTTCTTTTGCAACAGGAAACTGTTTACT
TATCACTTCAAGCAAATGGGAAAAACAAAAATATTACCTCTGAATATGGCCAAACCAGTAGCGGGCATCAGTTATCAGTACAAAAGAGTG
ATTCTTCTCAAAGCCTTGAATCACAATTAGCTTTGGATGAAGCTTTAGCTAGATCGTTGCAGTTAGGGGATAATTTTGAGGATTTCTGTA
GAGATGAGCTTAATTCTATTGTAGCTGGCATCGGGGAATCACCTCCTAGAGAATCACCTCCGGTTAGGGTGCAGGCTGAGAATCCAAACA
CGAGGATACAAGATGATATTGATCCAGATGGTATGACCTATGAGGAATTGCAGTCTTTAGGGGAAGCTGTTGGCCAGCAGAGCAGAGGGC
TTTCACAAGACCTCATACGTCGTTTACCAACTTTCAAATATAAGACTGGATTCTTTTCAAAGAAAAAGAAAATGGGAGAGTGTGTTATAT
GCTATGCTGCATACAGAAGTGGAGATATGTTGACCACTTTACCTTGTGCACACATGTTTCATTCAGAATGTATTAACCGCTGGCTAAAAG
AAAGAAAGAACTGCCCCCTCTGTTATGAAGAGGTGAAAGATGaATGACTTCCCAGGAAACGTCAAAGCXCTTGTTGCTCAATTGGATCTG
CCTTCAAATTCACTTTTCGCACATGTAGAGAGAATCGGCGCCCTTTAA\(3')AGACTTATATTTGGTTTGTAAATAGCTTTCTGGATTG
ATTATCCATATTGAACTATCTGGACATATTCTACTTGCTTATGCATTATGGTTTTCCTTTTTTATTAATGCAATATATATTAGACCATTA
AACAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan