ESTScan Details for Unigene SGN-U197189

Score 
646
Direction 
Forward
Predicted Peptide Sequence 
STVAFKLGPKAPVNYALEGSIAIAGAAVQWLRDSLGIISSASEIEELASKVTSTGGVYFVPAFNGLFAPWWRDDARGVCIGITRFTNKSH
IARAVLESMCFQVKDVLDSMHKDAGKKGEAKSEGKEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVYKDN
EIFASGQNMKQASIFKPVLEQELRKKKVX
Predicted Coding Sequence 
AGCACAGTAGCCTTTAAGCTGGGGCCAAAAGCACCTGTCAATTACGCTTTAGAAGGCTCCATTGCCATTGCTGGTGCTGCAGTTCAGTGG
CTTAGAGACAGTCTAGGCATTATCAGCAGTGCTAGTGAAATTGAGGAGTTGGCATCAAAAGTTACCTCTACTGGAGGAGTGTATTTTGTT
CCTGCATTTAATGGATTGTTTGCTCCATGGTGGCGTGATGATGCTCGTGGGGTTTGCATTGGTATAACTAGATTTACCAACAAGTCTCAC
ATTGCTCGAGCGGTACTTGAAAGCATGTGTTTTCAGGTAAAAGATGTGCTTGATTCCATGCACAAAGATGCTGGAAAGAAAGGTGAAGCT
AAGAGCGAGGGAAAAGAGTTCTTACTCCGCGTGGATGGTGGTGCTACAGTCAACAACCTTTTGATGCAAATTCAGGCTGACTTGTTGGGT
AGTCCAGTTGTAAGACCAGCTGATATAGAAACAACAGCTCTTGGGGCAGCCTATGCTGCCGGATTAGCTGTTGGAGTCTATAAGGACAAT
GAGATATTTGCTTCCGGGCAAAATATGAAGCAGGCGTCAATATTCAAACCTGTGTTAGAACAAGAATTGAGGAAAAAGAAGGTGGAX\
Edits in Original Sequence 
(5')AGCACAGTAGCCTTTAAGCTGGGGCCAAAAGCACCTGTCAATTACGCTTTAGAAGGCTCCATTGCCATTGCTGGTGCTGCAGTTCA
GTGGCTTAGAGACAGTCTAGGCATTATCAGCAGTGCTAGTGAAATTGAGGAGTTGGCATCAAAAGTTACCTCTACTGGAGGAGTGTATTT
TGTTCCTGCATTTAATGGATTGTTTGCTCCATGGTGGCGTGATGATGCTCGTGGGGTTTGCATTGGTATAACTAGATTTACCAACAAGTC
TCACATTGCTCGAGCGGTACTTGAAAGCATGTGTTTTCAGGTAAAAGATGTGCTTGATTCCATGCACAAAGATGCTGGAAAGAAAGGTGA
AGCTAAGAGCGAGGGAAAAGAGTTCTTACTCCGCGTGGATGGTGGTGCTACAGTCAACAACCTTTTGATGCAAATTCAGGCTGACTTGTT
GGGTAGTCCAGTTGTAAGACCAGCTGATATAGAAACAACAGCTCTTGGGGcCAGCCTATGCTGCCGGATTAGCTGTTGGAGTCTATAAGG
ACAATGAGATATTTGCTTCCGGGCAAAATATGAAGCAGGCGTCAATATTCAAACCTGTGTTAGAACAAGAATTGAGGAAAAAGAAGGTGG
AX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan