ESTScan Details for Unigene SGN-U197202

Score 
240
Direction 
Forward
Predicted Peptide Sequence 
VEFPXPNTPPAXVTDHFFKHAKVQSRRRGRKKMPLTATMVGAILGFGTQVYSNALRKLPIMRHPWEHLLGIGIGVVAVNQFVKWEVKCNE
DLNKLLEKSKHANERRYFDDGED
Predicted Coding Sequence 
GTGGAATTTCCTAAXCCTAATACTCCTCCTGCTXCAGTGACTGACCATTTCTTCAAACACGCAAAAGTGCAATCAAGAAGAAGAGGAAGA
AAGAAGATGCCGTTGACTGCAACAATGGTTGGAGCCATATTGGGTTTTGGTACCCAGGTGTACTCTAACGCCCTCCGCAAACTACCTATC
ATGCGCCATCCGTGGGAACATTTGTTGGGTATTGGAATTGGTGTAGTGGCTGTCAATCAGTTTGTCAAATGGGAAGTTAAGTGCAATGAA
GATCTGAACAAATTGCTCGAAAAATCTAAGCATGCCAATGAACGTCGTTACTTTGATGATGGCGAAGATTAA\
Edits in Original Sequence 
(5')GTGGAATTTCCTAAXCCTAATACTCCTCCTGCTXCAGTGACTGACCATTTCTTCAAACACGCAAAAGTGCAATCAAGAAGAAGAGG
AAGAAAGAAGATGCCGTTGACTGCAACAATGGTTGGAGCCATATTGGGTTTTGGTACCCAGGTGTACTCTAACGCCCTCCGCAAACTACC
TATCATGCGCCATCCGTGGGAACATTTGTTGGGTATTGGAATTGGTGTAGTGGCTGTCAATCAGTTTGTCAAATGGGAAGTTAAGTGCAA
TGAAGATCTGAACAAATTGCTCGAAAAATCTAAGCATGCCAATGAACGTCGTTACTTTGATGATGGCGAAGATTAA\(3')TACTATGGG
CGGTTTCCAGAGAATATGTTGCGATACCTACCAGCTCCAATGAGTCAAGTTTGCTTAAGCAGTTTTCCTTTTTGTAAGGTTTGCAGTACA
TTGATCTTTGTATCAGCGAAGAACACTTTGCAATAATCATATTTTGACTGTCTTGCAAAATGTGTTTCCTCTAATAATTACACCATTCAT
AGTCTCCTACGAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan