ESTScan Details for Unigene SGN-U197234

Score 
867
Direction 
Forward
Predicted Peptide Sequence 
VGKGGLRMAPEEALGEVLQVPLGCVTPFALVNESARCVSLLLDQGFKSQGCCFFHPLSNDTTIALNARDLDKFLSSIGKQPAYVDLEANP
PVGKDQPPDLASLVPSDAIAISGQPDKAAPSQVSDMNHAPVNNKSTGVSAKAVKPSTDVQKKKPSHGVSLSNTFADPEKFVENFIERTSS
LVLAEITKEHAKQSSEKLGEEALSDKIMKKLATELRSSATMFKNTAYSEGFSAGSRHQAK
Predicted Coding Sequence 
XXTGTGGGAAAAGGAGGGTTAAGAATGGCTCCTGAAGAAGCACTTGGGGAAGTACTTCAGGTACCGCTTGGTTGTGTCACCCCTTTTGCA
CTTGTAAATGAATCAGCAAGGTGTGTTTCCTTGTTGTTGGATCAAGGATTTAAATCTCAGGGATGCTGCTTCTTCCACCCACTCTCTAAT
GATACAACAATTGCTCTTAATGCTCGTGATCTCGATAAATTTCTGAGTTCCATTGGAAAGCAACCTGCCTATGTTGACCTGGAGGCTAAT
CCTCCAGTAGGAAAGGATCAACCTCCTGATCTAGCATCTCTTGTTCCGTCTGATGCAATTGCCATATCAGGTCAACCAGACAAAGCAGCT
CCTTCGCAAGTTTCTGACATGAATCATGCCCCTGTCAATAACAAGTCAACTGGAGTTTCAGCTAAAGCAGTTAAGCCATCAACTGATGTG
CAGAAGAAGAAACCATCACATGGAGTTAGCTTATCAAACACGTTTGCTGATCCCGAAAAATTTGTTGAAAACTTCATAGAGAGGACGTCA
TCTCTTGTTCTTGCAGAGATAACGAAGGAGCATGCAAAGCAATCCAGTGAGAAACTTGGTGAAGAAGCCTTATCAGATAAAATTATGAAA
AAGCTTGCGACAGAGCTACGGAGCTCAGCTACAATGTTCAAGAACACTGCGTATTCTGAAGGTTTTTCTGCTGGTAGTCGTCATCAAGCA
AAGTGA\
Edits in Original Sequence 
(5')XXTGTGGGAAAAGGAGGGTTAAGAATGGCTCCTGAAGAAGCACTTGGGGAAGTACTTCAGGTACCGCTTGGTTGTGTCACCCCTTT
TGCACTTGTAAATGAATCAGCAAGGTGTGTTTCCTTGTTGTTGGATCAAGGATTTAAATCTCAGGGATGCTGCTTCTTCCACCCACTCTC
TAATGATACAACAATTGCTCTTAATGCTCGTGATCTCGATAAATTTCTGAGTTCCATTGGAAAGCAACCTGCCTATGTTGACCTGGAGGC
TAATCCTCCAGTAGGAAAGGATCAACCTCCTGATCTAGCATCTCTTGTTCCGTCTGATGCAATTGCCATATCAGGTCAACCAGACAAAGC
AGCTCCTTCGCAAGTTTCTGACATGAATCATGCCCCTGTCAATAACAAGTCAACTGGAGTTTCAGCTAAAGCAGTTAAGCCATCAACTGA
TGTGCAGAAGAAGAAACCATCACATGGAGTTAGCTTATCAAACACGTTTGCTGATCCCGAAAAATTTGTTGAAAACTTCATAGAGAGGAC
GTCATCTCTTGTTCTTGCAGAGATAACGAAGGAGCATGCAAAGCAATCCAGTGAGAAACTTGGTGAAGAAGCCTTATCAGATAAAATTAT
GAAAAAGCTTGCGACAGAGCTACGGAGCTCAGCTACAATGTTCAAGAACACTGCGTATTCTGAAGGTTTTTCTGCTGGTAGTCGTCATCA
AGCAAAGTGA\(3')CTTTGAGATATGCTTGCTTGTTGTCTTGTATTTTAATTTGCATCCGATGAAAAACTGATGTCGTGATCCGATTCA
AGTGATGGCTAAAATTGTGAAGTGCAATTTGTTCCGTTGTATTTTGTGCAAGTCGAAACGTCTTTCATTAGTAACTCAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan