ESTScan Details for Unigene SGN-U197243

Score 
699
Direction 
Forward
Predicted Peptide Sequence 
LAFSTSQADNLYKLKFDLFVGGMTGHSGGHHGYPPCGGGYPPQGCYTYPPQGYPPQHQGHTYPPQGYPPAGYATQGRYGASHHSGHGGMG
ALLAGGAAAAAAAMGAHHLSHGSHHGGGYYGGGHYDHHGGMFKHHGGKFKHGKHGKSKRGKYGGKFGKWK
Predicted Coding Sequence 
XGTTTGGCGTTCTCAACTTCTCAAGCAGATAATCTTTACAAGCTXAAGTTTGATTTGTTTGTTGGTGGTATGACTGGTCATTCTGGTGGT
CATCATGGATATCCTCCATGCGGAGGAGGATATCCTCCTCAAGGGTGCTATACATATCCTCCTCAAGGGTACCCTCCGCAGCATCAGGGG
CATACATATCCTCCTCAAGGGTATCCTCCTGCTGGATATGCTACACAAGGTCGTTATGGTGCTTCACACCACTCAGGGCATGGTGGTATG
GGGGCTTTGTTAGCTGGAGGTGCTGCTGCTGCAGCTGCTGCCATGGGTGCTCATCATCTGTCGCATGGATCTCATCACGGAGGCGGTTAT
TATGGAGGTGGTCATTATGATCATCATGGAGGCATGTTTAAGCATCACGGAGGCAAGTTTAAGCATGGAAAGCATGGGAAATCCAAACGT
GGAAAGTATGGAGGGAAATTCGGCAAGTGGAAGTAA\
Edits in Original Sequence 
(5')XGTTTGGCGTTCTCAACTTCTCAAGCAGATAATCTTTACAAGCTXAAGTTTGATTTGTTTGTTGGTGGTATGACTGGTCATTCTGG
TGGTCATCATGGATATCCTCCATGCGGAGGAGGATATCCTCCTCAAGGGTGCTATACATATCCTCCTCAAGGGTACCCTCCGCAGCATCA
GGGGCATACATATCCTCCTCAAGGGTATCCTCCTGCTGGATATGCTACACAAGGTCGTTATGGTGCTTCACACCACTCAGGGCATGGTGG
TATGGGGGCTTTGTTAGCTGGAGGTGCTGCTGCTGCAGCTGCTGCCATGGGTGCTCATCATCTGTCGCATGGATCTCATCACGGAGGCGG
TTATTATGGAGGTGGTCATTATGATCATCATGGAGGCATGTTTAAGCATCACGGAGGCAAGTTTAAGCATGGAAAGCATGGGAAATCCAA
ACGTGGAAAGTATGGAGGGAAATTCGGCAAGTGGAAGTAA\(3')ACTAGTTATAGTATCAAAACACTTCACCTGCCTTTACAGTATGCT
AATAAGACATAATAAGATATGTTTATTATGGCCTACATAGGCCTGTGAGATGTTGTCTTCTTATATTGTATTTTCAATTCTAAAGTGAGT
G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan