ESTScan Details for Unigene SGN-U197266

Score 
159
Direction 
Forward
Predicted Peptide Sequence 
FPIDTPNTVIVAAXKGYLNYKETDQGKGATSXIVEEKEVEETRGAQGVDTVKHLSKKQYLGIHEXKEKYLIYNLVTSXKEVFIGSTRGSD
NFVKNGVFMEVSVFAEPAPIALILTAITVSYASAFRALNYGKEMERNRDWSEASITLDRSQAXYDPDSELLQLAYDVLFVLFFSQLLTVF
TAIASASSLYFCLFPYIAPIRSRFGLADPFVSQCCSKPFTXDPRPFDVAXALAR
Predicted Coding Sequence 
XXCTTCCCTATTGATACTCCAAACACCGTGATCGTCGCGGCGXTCAAAGGTTATTTGAATTACAAGGAGACTGATCAAGGTAAAGGTGCA
ACTTCTXATATAGTGGAAGAGAAGGAAGTAGAGGAAACTAGAGGTGCACAAGGTGTTGACACTGTTAAGCATCTTTCAAAAAAACAATAT
CTGGGAATTCATGAAATXAAGGAAAAGTATTTGATTTATAACCTTGTTACTTCTGAXAAGGAAGTGTTTATAGGTAGTACTAGGGGTAGT
GATAACTTTGTTAAAAATGGAGTCTTTATGGAAGTTAGTGTATTTGCTGAACCAGCACCCATTGCTCTTATTCTCACTGCCATAACTGTT
TCATATGCATCTGCGTTCCGAGCACTAAACTATGGCAAAGAAATGGAGAGAAATCGTGATTGGTCCGAAGCATCAATCACCTTAGACAGG
TCTCAGGCTXCTTATGATCCCGATAGTGAGCTCTTGCAGCTTGCTTATGATGTTCTATTTGTTCTCTTCTTCTCACAGCTCCTCACCGTG
TTTACTGCAATTGCCTCAGCATCATCTCTTTACTTTTGCCTATTCCCTTATATTGCCCCAATCAGGTCTAGGTTCGGCTTAGCTGACCCT
TTTGTATCTCAATGTTGTTCAAAGCCATTTACTAGXGATCCAAGGCCTTTTGATGTTGCTXATGCATTGGCACGGTAA\
Edits in Original Sequence 
(5')XXCTTCCCTATTGATACTCCAAACACCGTGATCGTCGCGGCGXTCAAAGGTTATTTGAATTACAAcGGAGACTGATCAAGGTAAAG
GTGCAACTTCTXATATAGTGGAAGAGAAGGAAGTAGAGGAAACTAGAGGTGCACAAGGTGTTgGACACTGTTAAGCATCTTTCAAAAAAA
CAATATCTGGGAATTCATGAAATXAAGGAAAAGTATTTGATTTATAACCTTGTTACTTCTGAXAAGGAAGTGTTTATAGGTAGTACTAGG
GGTAGTGcATAACTTTGTTAAAAATGGAGTCTTTATGGAAGTTAGTGTATTTGCtTGAACCAGCACCCATTGCTCTTATTCTCACTGCCA
TAACTGTTTCATATGCATCTGCGTTCCGAGCACTAAACTATGGCAAAGAAATGGAGAGAAATCGTGATTGGTCCGAAGCATCAATCACCT
TAGACAGGTCTCAGGCTXCTTATGATCCCGATAGTGAGCTCTTGCAGCTTGCTTATGATGTTCTATTTGTTCTCTTCTgTCTCACAGCTC
CTCACCGTGTTTACTGCAATTGCCTCAGCATCATCTCTTTACTTTTGCCTATTCCCTTATATTGCCCCAATCAGGTCTAGGTTCGGCTTA
GCTGACCCTTTTGTATCTCAATGTTGTTCAAAGCCATTTACTAGXGATCCAAGGCCTTTTGATGTTGCTXATGCATTGGCACGGTAA\(3')
TAACGTGGCTTGTCTCTGGTCATTGGATACTGAATAACTTGTTGGGCATCTCTCTTTGTATTGCTTTTGTGAGCCATGTTCGCCTTCC
TAACATTAAGATTTGTGCAATGCTTCTTGTATGCTTGTCTGTATATGACATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan