ESTScan Details for Unigene SGN-U197299

Score 
508
Direction 
Forward
Predicted Peptide Sequence 
MALGGGGPQRGTAAAAAANLRRRKTAGGGGAAGGAGGTMLQFYTDDSPGLKISPNVVLVMSIGFIAFVAILHVMGKLYFVRREAYRN
Predicted Coding Sequence 
ATGGCTTTGGGTGGAGGTGGACCACAAAGGGGGACTGCTGCAGCAGCTGCTGCTAACCTGCGTCGAAGGAAGACCGCTGGTGGTGGTGGA
GCTGCAGGAGGAGCAGGTGGTACCATGCTCCAATTCTACACTGACGATTCCCCTGGACTCAAGATATCCCCCAACGTTGTGCTTGTGATG
AGTATTGGCTTCATAGCCTTTGTCGCAATCCTTCATGTCATGGGTAAGCTCTACTTTGTCCGCAGAGAGGCCTACAGAAATTAA\
Edits in Original Sequence 
TAGAAAGCCAATTAAACAAACAACGGGTCAAAAAATTTCCCATCCATTTTTCCAGCAGATCGAACACACCATTTTCCTCTAATTCTCAGC
ATCCTCAGTGACTAGAA
(5')ATGGCTTTGGGTGGAGGTGGACCACAAAGGGGGACTGCTGCAGCAGCTGCTGCTAACCTGCGTCGAAGG
AAGACCGCTGGTGGTGGTGGAGCTGCAGGAGGAGCAGGTGGTACCATGCTCCAATTCTACACTGACGATTCCCCTGGACTCAAGATATCC
CCCAACGTTGTGCTTGTGATGAGTATTGGCTTCATAGCCTTTGTCGCAATCCTTCATGTCATGGGTAAGCTCTACTTTGTCCGCAGAGAG
GCCTACAGAAATTAA\(3')GACACCTCATTGCTGACTTGGGAAAGTTTTGTTGGGCAACAGTGTTCTTCCTTGAAGGAAAACTGGCATT
GTAGTTTTATTTTCTTTATGTTCGTCTATGTAATGAAGTTTATAGAAAAGTTCTCTAGTTATGAGTTTACTGTTTCTTGTGCTANAAAAA
AAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan