ESTScan Details for Unigene SGN-U197437

Score 
11
Direction 
Forward
Predicted Peptide Sequence 
SDKESQLHTLDVHANRIHGHLPVNLIRYPNLTEVNLGHNLFSGEIPSEYWPRLGFSWRSLNLEYNXPGGIGAPRPQQDFEGVQGSFEHNC
LICPKGLQLCHGQRPASECHGGNXQLVEIFS
Predicted Coding Sequence 
TCTGATAAAGAATCACAGCTTCACACACTGGACGTACATGCCAATCGTATACATGGCCATTTGCCTGTGAACTTGATTAGGTACCCAAAC
TTAACGGAAGTAAACCTTGGACATAACCTGTTTTCGGGCGAGATTCCATCAGAATATTGGCCACGACTCGGGTTTTCATGGAGAAGTCTC
AACTTGGAATATAATAAXCCTGGAGGGATCGGTGCCCCGAGACCTCAACAGGACTTTGAAGGGGTTCAGGGAAGTTTTGAACACAACTGT
CTCATTTGTCCGAAGGGCTTGCAGCTATGTCATGGACAGAGGCCAGCATCAGAATGTCATGGAGGAAACCAXCAATTAGTTGAGATATTT
AGCTAG\
Edits in Original Sequence 
(5')TCTGATAAAGAATCACAGCTTCACACACTGGACGTACATGCCAATCGTATACATGGCCATTTGCCTGTGAACTTGATTAGGTACCC
AAACTTAACGGAAGTAAACCTTGGACATAACCTGTTTTCGGGCGAGATTCCATCAGAATATTGGCCACGACTCGGGTTTTCATGGAGAAG
TCTCAACTTGGAATATAATAAXCCTGGAGGGATCGGTGCCCCGAGACCTCAACAGGACTTTaGAAGGGGTTCAGGGAAGTTTTGAACACA
ACTGTCTCATTTGTCCGAAGGGCTTGCAGCTATGTCATGGACAGAGGCCAGCATCAGAATGTCATGGAGGAAACCAXCAATTAGTTGAGA
TATTTAGCTAG\(3')CGTCAGAATGTCATGGAGGAGACCATAATTAGTTGAGAGATTTAGCTTTTGAATGTCTTGAAAATTACTTACTT
TACATGTATGGAATATCTAATGTCAGTTTTTCAAGGTTAAATGTTTTCCTAGTTCCCAATATAGTTTATCAGTTGTAGCCTGTTATTTCA
ATGAATAACGAGTAGCATTGGAATGAAGCAGCTCATATCTTCAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan