ESTScan Details for Unigene SGN-U197488

Score 
227
Direction 
Forward
Predicted Peptide Sequence 
LIKLKWGGKVIRNSFISGEFSEEXNVMIIRGKDKGETGIVKRVVRSQNRVIVEGKNLVKKHIKQGQGHEGGIFTVEAPLHVSNVQLVDPV
TGKPTKVGIRYLDDGSKVRVSRGIGASGSIIPRPEILKTRTTPRPTVAGPKDTPMDVVMERTYDPKTGKGMPDLLRKCGAEASNLMQYFC
ENTVVIYFILQTLNTX
Predicted Coding Sequence 
XCTTTGATTAAGCTCAAATGGGGTGGAAAAGTTATCAGAAACTCATTCATCAGTGGAGAATTCTCAGAGGAGATXAATGTCATGATTATC
AGAGGAAAAGATAAAGGCGAGACTGGTATCGTTAAGCGTGTCGTACGTTCTCAAAACCGTGTAATTGTCGAGGGGAAAAACTTGGTCAAG
AAACATATCAAACAAGGGCAAGGCCATGAAGGTGGAATATTTACAGTTGAAGCCCCGCTGCATGTATCCAATGTTCAGCTTGTAGATCCA
GTCACAGGGAAACCAACCAAGGTCGGAATTAGATACCTGGACGATGGCTCCAAAGTAAGAGTGTCGAGAGGTATAGGAGCATCAGGTTCT
ATAATTCCCCGGCCCGAGATCTTAAAAACAAGAACCACACCAAGGCCTACAGTTGCTGGTCCTAAGGATACTCCAATGGACGTTGTCATG
GAGAGGACATATGATCCAAAAACAGGAAAAGGCATGCCAGATCTCCTAAGAAAATGTGGTGCAGAAGCTAGTAATCTAATGCAATACTTT
TGTGAGAACACGGTTGTTATTTATTTCATTTTACAAACTCTTAACACTGXX\
Edits in Original Sequence 
(5')XCTTTGATTAAGCTCAAATGGGGTGGAAAAGTTATCAGAAACTCATTCATCAGTGGAGAATTCTCAGAGGAGATXAATGTCATGAT
TATCAGAGGAAAAGATAAAGGCGAGACTGGTATCGTTAAGCGTGTCGTACGTTCTCAAAACCGTGTAATTGTCGAGGGGAAAAACTTGGT
CAAGAAACATATCAAACAAGGGCAAGGCCATGAAGGTGGAATATTTACAGTTGAAGCCCCGCTGCATGTATCCAATGTTCAGCTTGTAGA
TCCAGTCACAGGGAAACCAACCAAGGTCGGAATTAGATACCTGGACGATGGCTCCAAAGTAAGAGTGTCGAGAGGTATAGGAGCATCAGG
TTCTATAATTCCCCGGCCCGAGATCTTAAAAACAAGAACCACACCAAGGCCTACAGTTGCTGGTCCTAAGGATACTCCAATGGACGTTGT
CATGGAGAGGACATATGATCCAAAAACAGGAAAAGGCATGCCAGATCTCCTAAGAAAATGTGGTGCAGAAGCTAGTAATCTAATGCAATA
CTTTTGTGAGAACACGGTTGTTATTTATTTCATTTTACAAACTCTTAACACTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan